C5a anaphylatoxin chemotactic receptor C5L2 (Gpr77) Recombinant Protein | Gpr77 recombinant protein
Recombinant Mouse C5a anaphylatoxin chemotactic receptor C5L2 (Gpr77)
Gene Names
C5ar2; C5L2; Gpr77; E030029A11Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C5a anaphylatoxin chemotactic receptor C5L2 (Gpr77); Recombinant Mouse C5a anaphylatoxin chemotactic receptor C5L2 (Gpr77); Gpr77 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-344aa; full length protein
Sequence
MMNHTTSEYYDYEYDHEHYSDLPDVPVDCPAGTCFTSDVYLIVLLVLYAAVFLVGVPGNT LVAWVTWKESRHRLGASWFLHLTMADLLCCVSLPFLAVPIAQKGHWPYGAAGCWLLSSIT ILSMYASVLLLTGLSGDLFLLAFRPSWKGADHRTFGVRVVQASSWMLGLLLTVPSAVYRR LLQEHYPPRLVCGIDYGGSVSAEVAITTVRFLFGFLGPLVFMAGCHGILQRQMARRHWPL GTAVVVGFFICWTPYHVLRVIIAAAPPHSLLLARVLEAEPLFNGLALAHSALNPIMFLYF GRKQLCKSLQAACHWALRDPQDEESAVTKVSISTSHEMVSEMPV
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Gpr77 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
38,199 Da
NCBI Official Full Name
C5a anaphylatoxin chemotactic receptor 2 isoform 2
NCBI Official Synonym Full Names
complement component 5a receptor 2
NCBI Official Symbol
C5ar2
NCBI Official Synonym Symbols
C5L2; Gpr77; E030029A11Rik
NCBI Protein Information
C5a anaphylatoxin chemotactic receptor 2
UniProt Protein Name
C5a anaphylatoxin chemotactic receptor 2
UniProt Gene Name
C5ar2
UniProt Synonym Gene Names
C5l2; Gpr77
UniProt Entry Name
C5AR2_MOUSE
Uniprot Description
C5AR2: Receptor for the chemotactic and inflammatory C3a, C4a and C5a anaphylatoxin peptides and also for their dearginated forms ASP/C3adesArg, C4adesArg and C5adesArg respectively. Couples weakly to G(i)-mediated signaling pathways. Belongs to the G-protein coupled receptor 1 family.
Protein type: Membrane protein, integral; Receptor, GPCR; Membrane protein, multi-pass; GPCR, family 1
Cellular Component: apical part of cell; basal plasma membrane; integral to membrane; membrane; plasma membrane
Molecular Function: C5a anaphylatoxin receptor activity; G-protein coupled receptor activity; signal transducer activity
Biological Process: chemotaxis; G-protein coupled receptor protein signaling pathway; inflammatory response; negative regulation of tumor necrosis factor production; positive regulation of epithelial cell proliferation; signal transduction
Research Articles on Gpr77
Similar Products
Product Notes
The Gpr77 c5ar2 (Catalog #AAA7016250) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-344aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Gpr77 c5ar2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MMNHTTSEYY DYEYDHEHYS DLPDVPVDCP AGTCFTSDVY LIVLLVLYAA VFLVGVPGNT LVAWVTWKES RHRLGASWFL HLTMADLLCC VSLPFLAVPI AQKGHWPYGA AGCWLLSSIT ILSMYASVLL LTGLSGDLFL LAFRPSWKGA DHRTFGVRVV QASSWMLGLL LTVPSAVYRR LLQEHYPPRL VCGIDYGGSV SAEVAITTVR FLFGFLGPLV FMAGCHGILQ RQMARRHWPL GTAVVVGFFI CWTPYHVLRV IIAAAPPHSL LLARVLEAEP LFNGLALAHS ALNPIMFLYF GRKQLCKSLQ AACHWALRDP QDEESAVTKV SISTSHEMVS EMPV. It is sometimes possible for the material contained within the vial of "C5a anaphylatoxin chemotactic receptor C5L2 (Gpr77), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
