Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Complement C5 Recombinant Protein | C5 recombinant protein

Complement C5

Gene Names
C5; C5D; C5a; C5b; ECLZB; CPAMD4
Applications
ELISA, Western Blot
Purity
?90%
Synonyms
Complement C5; CPAMD4; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4; C5 recombinant protein
Ordering
Host
E Coli
Purity/Purification
?90%
Form/Format
Liquid
Sequence
PDKKFSYSSGHVHLSSENKFQNSAILTIQPKQLPGGQNPVSYVYLEVVSKHFSKSKRMPITYDNGFLFIHTDKPVYTPDQSVKVRVYSLNDDLKPAKRETVLTFIDPEGSEVDMVEEIDHIGIISFPDFKIPSNPRYGMWTIKAKYKEDFSTTGTAYFEVKEYVLPHFSVSIEPEYNFIGYKNFKNFEITIKARYFYNKVVTEADVYITFGIREDLKDD
Applicable Applications for C5 recombinant protein
ELISA (EIA), Western Blot (WB), Affinity Purification (AP)
Tags
His
Species
Human
Storage Buffer
50mM NaH2PO4, 500mM NaCl Buffer with 500mM Imidazole,10%glycerol(PH8.0)
Preparation and Storage
Store at -20 degree C.
Avoid repeated freezing and thawing.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
727
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24.3KD
NCBI Official Full Name
complement C5 isoform 2
NCBI Official Synonym Full Names
complement C5
NCBI Official Symbol
C5
NCBI Official Synonym Symbols
C5D; C5a; C5b; ECLZB; CPAMD4
NCBI Protein Information
complement C5
UniProt Protein Name
Complement C5
Protein Family
UniProt Gene Name
C5
UniProt Synonym Gene Names
CPAMD4

NCBI Description

This gene encodes a component of the complement system, a part of the innate immune system that plays an important role in inflammation, host homeostasis, and host defense against pathogens. The encoded preproprotein is proteolytically processed to generate multiple protein products, including the C5 alpha chain, C5 beta chain, C5a anaphylatoxin and C5b. The C5 protein is comprised of the C5 alpha and beta chains, which are linked by a disulfide bridge. Cleavage of the alpha chain by a convertase enzyme results in the formation of the C5a anaphylatoxin, which possesses potent spasmogenic and chemotactic activity, and the C5b macromolecular cleavage product, a subunit of the membrane attack complex (MAC). Mutations in this gene cause complement component 5 deficiency, a disease characterized by recurrent bacterial infections. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2015]

Uniprot Description

Activation of C5 by a C5 convertase initiates the spontaneous assembly of the late complement components, C5-C9, into the membrane attack complex. C5b has a transient binding site for C6. The C5b-C6 complex is the foundation upon which the lytic complex is assembled.Derived from proteolytic degradation of complement C5, C5 anaphylatoxin is a mediator of local inflammatory process. Binding to the receptor C5AR1 induces a variety of responses including intracellular calcium release, contraction of smooth muscle, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes (PubMed:8182049). C5a is also a potent chemokine which stimulates the locomotion of polymorphonuclear leukocytes and directs their migration toward sites of inflammation.

Research Articles on C5

Similar Products

Product Notes

The C5 c5 (Catalog #AAA2889413) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Complement C5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB), Affinity Purification (AP). Researchers should empirically determine the suitability of the C5 c5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PDKKFSYSSG HVHLSSENKF QNSAILTIQP KQLPGGQNPV SYVYLEVVSK HFSKSKRMPI TYDNGFLFIH TDKPVYTPDQ SVKVRVYSLN DDLKPAKRET VLTFIDPEGS EVDMVEEIDH IGIISFPDFK IPSNPRYGMW TIKAKYKEDF STTGTAYFEV KEYVLPHFSV SIEPEYNFIG YKNFKNFEIT IKARYFYNKV VTEADVYITF GIREDLKDD . It is sometimes possible for the material contained within the vial of "Complement C5, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.