SDS-PAGE
UPF0568 protein C14orf166 (C14orf166) Recombinant Protein | C14orf166 recombinant protein
Recombinant Human UPF0568 protein C14orf166 (C14orf166)
Gene Names
C14orf166; CLE; CLE7; CGI99; RLLM1; CGI-99; LCRP369
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
UPF0568 protein C14orf166 (C14orf166); Recombinant Human UPF0568 protein C14orf166 (C14orf166); UPF0568 protein C14orf166; CLE7 homolog; CLE; C14orf166 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-244aa; Full Length
Sequence
MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANLLQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR
Sequence Length
244
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for C14orf166 recombinant protein
RNA-binding protein involved in modulation of mRNA transcription by Polymerase II. In case of infection by influenza virus A, is involved in viral replication. Component of the tRNA-splicing ligase complex and is required for tRNA ligation. May be required for RNA transport
Product Categories/Family for C14orf166 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55.1 kDa
NCBI Official Full Name
UPF0568 protein C14orf166
NCBI Official Synonym Full Names
chromosome 14 open reading frame 166
NCBI Official Symbol
C14orf166
NCBI Official Synonym Symbols
CLE; CLE7; CGI99; RLLM1; CGI-99; LCRP369
NCBI Protein Information
UPF0568 protein C14orf166; CLE7 homolog; RLL motif containing 1
UniProt Protein Name
UPF0568 protein C14orf166
Protein Family
UniProt Gene Name
C14orf166
UniProt Synonym Gene Names
CLE
UniProt Entry Name
CN166_HUMAN
Uniprot Description
C14orf166: Involved in modulation of mRNA transcription by Polymerase II. In case of infection by influenza virus A, is involved in viral replication. Belongs to the UPF0568 family.
Protein type: Unknown function
Chromosomal Location of Human Ortholog: 14q22.1
Cellular Component: nucleoplasm; perinuclear region of cytoplasm; cytoplasm; microtubule organizing center; cytosol; nucleus
Molecular Function: identical protein binding; protein binding; RNA binding
Biological Process: tRNA splicing; transcription, DNA-dependent; viral reproduction; positive regulation of transcription from RNA polymerase II promoter; RNA transport
Research Articles on C14orf166
Similar Products
Product Notes
The C14orf166 c14orf166 (Catalog #AAA1434513) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-244aa; Full Length. The amino acid sequence is listed below: MFRRKLTALD YHNPAGFNCK DETEFRNFIV WLEDQKIRHY KIEDRGNLRN IHSSDWPKFF EKYLRDVNCP FKIQDRQEAI DWLLGLAVRL EYGDNAEKYK DLVPDNSKTA DNATKNAEPL INLDVNNPDF KAGVMALANL LQIQRHDDYL VMLKAIRILV QERLTQDAVA KANQTKEGLP VALDKHILGF DTGDAVLNEA AQILRLLHIE ELRELQTKIN EAIVAVQAII ADPKTDHRLG KVGR. It is sometimes possible for the material contained within the vial of "UPF0568 protein C14orf166 (C14orf166), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
