C-C motif chemokine 24 Recombinant Protein | CCL24 recombinant protein
Recombinant human C-C motif chemokine 24 protein
Gene Names
CCL24; Ckb-6; MPIF2; MPIF-2; SCYA24
Applications
SDS-Page, ELISA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C-C motif chemokine 24; Recombinant human C-C motif chemokine 24 protein; CK-beta-6 Eosinophil chemotactic protein 2 Eotaxin-2 Myeloid progenitor inhibitory factor 2; MPIF-2 Small-inducible cytokine A24; CCL24 recombinant protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence
VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC
Applicable Applications for CCL24 recombinant protein
SDS-PAGE, Standard, Sandwitch ELISA (EIA)
Preparation and Storage
Store at -20 degree C. For extended storage,conserve at -20 degree C or -80 degree C.
Related Product Information for CCL24 recombinant protein
Chemotactic for resting T-lymphocytes, and eosinophils. Has lower chemotactic activity for neutrophils but none for monocytes and activated lymphocytes. Is a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line. Binds to CCR3.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
17 bp
NCBI Official Full Name
C-C motif chemokine 24
NCBI Official Synonym Full Names
chemokine (C-C motif) ligand 24
NCBI Official Symbol
CCL24
NCBI Official Synonym Symbols
Ckb-6; MPIF2; MPIF-2; SCYA24
NCBI Protein Information
C-C motif chemokine 24
Protein Family
Research Articles on CCL24
Similar Products
Product Notes
The CCL24 (Catalog #AAA953417) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's C-C motif chemokine 24 can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, Standard, Sandwitch ELISA (EIA). Researchers should empirically determine the suitability of the CCL24 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VVIPSPCCMF FVSKRIPENR VVSYQLSSRS TCLKAGVIFT TKKGQQFCGD PKQEWVQRYM KNLDAKQKKA SPRARAVAVK GPVQRYPGNQ TTC. It is sometimes possible for the material contained within the vial of "C-C motif chemokine 24, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
