Blood vessel epicardial substance-A (bves-a) Recombinant Protein | bves-a recombinant protein
Recombinant Xenopus laevis Blood vessel epicardial substance-A (bves-a)
Gene Names
bves-a; pop1; Xbves; pop-1; Xpop-1; pop1-A; popdc1; Xbves-A; Popeye-1; Xpop-1-A; popdc1-A
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Blood vessel epicardial substance-A (bves-a); Recombinant Xenopus laevis Blood vessel epicardial substance-A (bves-a); bves-a recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-338aa; full length protein
Sequence
MTTESIFITTLPMDFNSQFDNITIGLNDNETLCENWREIHHLVFHLANTCFAAGLVIPST LNLHMLFLRGMLCLGCTFFIIWAVLFRCALDIMIWNATFLSINFMHFVYLVYKKRPIKIK KELKGIYHRMFEPLHVSPELFNRLTGQFCEIKTLAKGQTYAVEDKTSVDDRLSILLKGIM KVSYRGHFLHTISANAYIDSPEFRSTEMNRGETFQVTITADDNCVFLCWSRERLTYFLES EPFLYEIFKYLIGKDITTKLYSLNDPTLGKKRKLDTQPSLCSQLSVMEMRNSLASTNDNE DGLQNFLRGTSTTSSQRNKQQEFYNAYGVGPLSHAVFC
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Xenopus laevis (African clawed frog)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for bves-a recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
37,690 Da
NCBI Official Full Name
blood vessel epicardial substance-A
NCBI Official Synonym Full Names
blood vessel epicardial substance
NCBI Official Symbol
bves-a
NCBI Official Synonym Symbols
pop1; Xbves; pop-1; Xpop-1; pop1-A; popdc1; Xbves-A; Popeye-1; Xpop-1-A; popdc1-A
NCBI Protein Information
blood vessel epicardial substance-A
UniProt Protein Name
Blood vessel epicardial substance-A
Protein Family
UniProt Gene Name
bves-a
UniProt Synonym Gene Names
pop1-a; popdc1-a; Xbves-A; Popeye protein 1-A; Xpop-1-A
UniProt Entry Name
PPD1A_XENLA
Uniprot Description
Cell adhesion molecule involved in the establishment and/or maintenance of cell integrity. Plays a role in vamp3-mediated vesicular transport and recycling of different receptor molecules. May be involved in the formation and regulation of the tight junction (TJ) paracellular permeability barrier in epithelial cells. May induce primordial adhesive contact and aggregation of epithelial cells in a Ca2+-independent manner. May be involved in epithelial movement during corneal sheet formation and regeneration. May play a role in the regulation of cell shape and movement by modulating the Rho-GTPase activity. May also be involved in striated muscle regeneration and in the regulation of cell spreading.
Research Articles on bves-a
Similar Products
Product Notes
The bves-a bves-a (Catalog #AAA7010498) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-338aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the bves-a bves-a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTTESIFITT LPMDFNSQFD NITIGLNDNE TLCENWREIH HLVFHLANTC FAAGLVIPST LNLHMLFLRG MLCLGCTFFI IWAVLFRCAL DIMIWNATFL SINFMHFVYL VYKKRPIKIK KELKGIYHRM FEPLHVSPEL FNRLTGQFCE IKTLAKGQTY AVEDKTSVDD RLSILLKGIM KVSYRGHFLH TISANAYIDS PEFRSTEMNR GETFQVTITA DDNCVFLCWS RERLTYFLES EPFLYEIFKY LIGKDITTKL YSLNDPTLGK KRKLDTQPSL CSQLSVMEMR NSLASTNDNE DGLQNFLRGT STTSSQRNKQ QEFYNAYGVG PLSHAVFC. It is sometimes possible for the material contained within the vial of "Blood vessel epicardial substance-A (bves-a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
