Bombesin receptor subtype-3 (Brs3) Recombinant Protein | Brs3 recombinant protein
Recombinant Mouse Bombesin receptor subtype-3 (Brs3)
Gene Names
Brs3; BRS-3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Bombesin receptor subtype-3 (Brs3); Recombinant Mouse Bombesin receptor subtype-3 (Brs3); Brs3 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-399aa; Full length protein
Sequence
MSQRQSQSPNQTLISITNDTETSSSVVSNDTTHKGWTGDNSPGIEALCAIYITYAGIISV GILGNAILIKVFFKTKSMQTVPNIFITSLAFGDLLLLLTCVPVDATHYLAEGWLFGKVGC KVLSFIRLTSVGVSVFTLTILSADRYKAVVKPLERQPPNAILKTCAKAGGIWIVSMIFAL PEAIFSNVYTFQDPNRNVTFESCNSYPISERLLQEIHSLLCFLVFYIIPLSIISVYYSLI ARTLYKSTLNIPTEEQSHARKQIESRKRIAKTVLVLVALFALCWLPNHLLYLYHSFTYES YANHSDVPFVIIIFSRVLAFSNSCVNPFALYWLSKTFQQHFKAQLCCLKAEQPEPPLGDI PLNNLTVMGRVPATGSAHVSEISVTLFSGSSAKKGEDKV
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Brs3 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
44,229 Da
NCBI Official Full Name
bombesin receptor subtype-3
NCBI Official Synonym Full Names
bombesin-like receptor 3
NCBI Official Symbol
Brs3
NCBI Official Synonym Symbols
BRS-3
NCBI Protein Information
bombesin receptor subtype-3
UniProt Protein Name
Bombesin receptor subtype-3
Protein Family
UniProt Gene Name
Brs3
UniProt Synonym Gene Names
BRS-3
UniProt Entry Name
BRS3_MOUSE
Uniprot Description
BRS3: Role in sperm cell division, maturation, or function. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Belongs to the G-protein coupled receptor 1 family.
Protein type: Membrane protein, multi-pass; Membrane protein, integral; GPCR, family 1; Receptor, GPCR
Cellular Component: cell soma; integral to membrane; membrane; neuron projection; plasma membrane
Molecular Function: bombesin receptor activity; G-protein coupled receptor activity; peptide receptor activity, G-protein coupled; signal transducer activity
Biological Process: bombesin receptor signaling pathway; G-protein coupled receptor protein signaling pathway; signal transduction
Research Articles on Brs3
Similar Products
Product Notes
The Brs3 brs3 (Catalog #AAA7010467) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-399aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Brs3 brs3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSQRQSQSPN QTLISITNDT ETSSSVVSND TTHKGWTGDN SPGIEALCAI YITYAGIISV GILGNAILIK VFFKTKSMQT VPNIFITSLA FGDLLLLLTC VPVDATHYLA EGWLFGKVGC KVLSFIRLTS VGVSVFTLTI LSADRYKAVV KPLERQPPNA ILKTCAKAGG IWIVSMIFAL PEAIFSNVYT FQDPNRNVTF ESCNSYPISE RLLQEIHSLL CFLVFYIIPL SIISVYYSLI ARTLYKSTLN IPTEEQSHAR KQIESRKRIA KTVLVLVALF ALCWLPNHLL YLYHSFTYES YANHSDVPFV IIIFSRVLAF SNSCVNPFAL YWLSKTFQQH FKAQLCCLKA EQPEPPLGDI PLNNLTVMGR VPATGSAHVS EISVTLFSGS SAKKGEDKV. It is sometimes possible for the material contained within the vial of "Bombesin receptor subtype-3 (Brs3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
