Breast cancer type 2 susceptibility protein homolog (Brca2) Recombinant Protein | Brca2 recombinant protein

Recombinant Mouse Breast cancer type 2 susceptibility protein homolog (Brca2) , partial

Cat. Num. AAA1059324

• Gene Names: Brca2; Fancd1; RAB163
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Breast cancer type 2 susceptibility protein homolog (Brca2); Recombinant Mouse Breast cancer type 2 susceptibility protein homolog (Brca2); partial; Brca2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2402-2753, Partial, provide the region interaction with SHFM1/DSS1.
• Sequence: MSSLQSARDLQDMRIKNKERRHLRLQPGSLYLTKSSTLPRISLQAAVGDRAPSACSPKQLYIYGVSKECINVNSKNAEYFQFDIQDHFGKEDLCAGKGFQLADGGWLIPSNDGKAGKEEFYRALCDTPGVDPKLISSIWVANHYRWIVWKLAAMEFAFPKEFANRCLNPERVLLQLKYRYDVEIDNSRRSALKKILERDDTAAKTLVLCISDIISPSTKVSETSGGKTSGEDANKVDTIELTDGWYAVRAQLDPPLMALVKSGKLTVGQKIITQGAELVGSPDACAPLEAPDSLRLKISANSTRPARWHSRLGFFRDPRPFPLPLSSLFSDGGNVGCVDIIVQRVYPLQWVE
• Sequence Length: 2753

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Brca2 recombinant protein

Inherited mutations in BRCA1 and this gene, BRCA2, confer increased lifetime risk of developing breast or ovarian cancer. Both BRCA1 and BRCA2 are involved in maintenance of genome stability, specifically the homologous recombination pathway for double-strand DNA repair. The BRCA2 protein contains several copies of a 70 aa motif called the BRC motif, and these motifs mediate binding to the RAD51 recombinase which functions in DNA repair. BRCA2 is considered a tumor suppressor gene, as tumors with BRCA2 mutations generally exhibit loss of heterozygosity (LOH) of the wild-type allele.

NCBI and Uniprot Product Information

• NCBI GI #: 124487409
• NCBI GeneID: 12190
• NCBI Accession #: NP_001074470.1
• NCBI GenBank Nucleotide #: NM_001081001.2
• UniProt Accession #: P97929; O35922; P97383; F8VPU5
• Molecular Weight: 370,664 Da
• NCBI Official Full Name: breast cancer type 2 susceptibility protein homolog
• NCBI Official Synonym Full Names: breast cancer 2, early onset
• NCBI Official Symbol: Brca2
• NCBI Official Synonym Symbols: Fancd1; RAB163
• NCBI Protein Information: breast cancer type 2 susceptibility protein homolog
• UniProt Protein Name: Breast cancer type 2 susceptibility protein homolog
• Protein Family: Breast cancer type 2 susceptibility protein
• UniProt Gene Name: Brca2
• UniProt Synonym Gene Names: Fancd1

Uniprot Description

Involved in double-strand break repair and/or homologous recombination. Binds RAD51 and potentiates recombinational DNA repair by promoting assembly of RAD51 onto single-stranded DNA (ssDNA). Acts by targeting RAD51 to ssDNA over double-stranded DNA, enabling RAD51 to displace replication protein-A (RPA) from ssDNA and stabilizing RAD51-ssDNA filaments by blocking ATP hydrolysis. Part of a PALB2-scaffolded HR complex containing RAD51C and which is thought to play a role in DNA repair by HR. May participate in S phase checkpoint activation. Binds selectively to ssDNA, and to ssDNA in tailed duplexes and replication fork structures. May play a role in the extension step after strand invasion at replication-dependent DNA double-strand breaks; together with PALB2 is involved in both POLH localization at collapsed replication forks and DNA polymerization activity. In concert with NPM1, regulates centrosome duplication. Interacts with the TREX-2 complex (transcription and export complex 2) subunits PCID2 and SEM1, and is required to prevent R-loop-associated DNA damage and thus transcription-associated genomic instability, independently of its known role in homologous recombination ().