Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

B-Raf Proto-Oncogene Recombinant Protein | BRAF recombinant protein

Recombinant Human B-Raf Proto-Oncogene

Gene Names
BRAF; NS7; BRAF1; RAFB1; B-RAF1
Purity
Greater than 80.0% as determined by SDS-PAGE.
Synonyms
B-Raf Proto-Oncogene; Recombinant Human B-Raf Proto-Oncogene; BRAF Human; B-Raf Proto-Oncogene Human Recombinant; Serine/Threonine Kinase; V-Raf Murine Sarcoma Viral Oncogene Homolog B1; V-Raf Murine Sarcoma Viral Oncogene Homolog B; Proto-Oncogene B-Raf; BRAF1; RAFB1; NS7; B-Raf Proto-Oncogene Serine/Threonine-Protein Kinase (P94); Murine Sarcoma Viral (V-Raf) Oncogene Homolog B1; Serine/Threonine-Protein Kinase B-Raf; 94 KDa B-Raf Protein; EC 2.7.11.1; B-RAF1; P94; Serine/threonine-protein kinase B-raf; Proto-oncogene B-Raf; p94; v-Raf murine sarcoma viral oncogene homolog B1; BRAF recombinant protein
Ordering
For Research Use Only!
Host
E. coli
Purity/Purification
Greater than 80.0% as determined by SDS-PAGE.
Form/Format
BRAF protein solution (0.25mg/ml) containing 20mM Tris-HCl (pH8.0) and 10% glycerol.
Sequence
MGSSHHHHHH SSGLVPRGSHMGSEF SEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGAFPVH
Sequence Length
766
Physical Appearance
Sterile Filtered colorless solution.
Preparation and Storage
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
Related Product Information for BRAF recombinant protein
BRAF Human Recombinant produced in E Coli is a single, non-glycosylated polypeptide chain containing 360 amino acids (432-766a.a) and having a molecular mass of 40.6kDa. BRAF is fused to a 25 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
Product Categories/Family for BRAF recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
673
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
serine/threonine-protein kinase B-raf
NCBI Official Synonym Full Names
B-Raf proto-oncogene, serine/threonine kinase
NCBI Official Symbol
BRAF
NCBI Official Synonym Symbols
NS7; BRAF1; RAFB1; B-RAF1
NCBI Protein Information
serine/threonine-protein kinase B-raf
UniProt Protein Name
Serine/threonine-protein kinase B-raf
UniProt Gene Name
BRAF
UniProt Synonym Gene Names
BRAF1; RAFB1
UniProt Entry Name
BRAF_HUMAN

Uniprot Description

BRAF: a tyrosine kinase-like kinase of the RAF family. Involved in the transduction of mitogenic signals from the cell membrane to the nucleus. May play a role in the postsynaptic responses of hippocampal neuron. Frequently mutated in thyroid cancers, skin melanomas and at lower frequency in a wide range of human cancers. An activating mutation, mimicking phosphorylation of the activation loop, is seen in 60% of malignant melanoma samples. Raf mutations are generally exclusive to Ras activating mutations. Activating mutations are also seen in ~10% of colorectal cancers, in lung cancers and gliomas, and at a lower rate in several other tumors. Inactivating mutations are also seen and may result in activation of c-Raf and Erk. Mutations in B-Raf, MEK1 and MEK2 also associated with cardiofaciocutaneous syndrome, displaying morphological, cardiac and mental defects. Approved Inhibitor: Nexavar/Sorafenib.

Protein type: EC 2.7.11.1; Kinase, protein; Oncoprotein; Protein kinase, Ser/Thr (non-receptor); Protein kinase, TKL; RAF family; TKL group

Chromosomal Location of Human Ortholog: 7q34

Cellular Component: cytoplasm; cytosol; intracellular; intracellular membrane-bound organelle; plasma membrane

Molecular Function: calcium ion binding; identical protein binding; MAP kinase kinase kinase activity; mitogen-activated protein kinase kinase binding; protein binding; protein kinase activity; protein serine/threonine kinase activity; small GTPase binding

Biological Process: cell differentiation; glucose transport; MAPKKK cascade; negative regulation of apoptosis; negative regulation of signal transduction; organ morphogenesis; positive regulation of peptidyl-serine phosphorylation; protein amino acid phosphorylation

Disease: Cardiofaciocutaneous Syndrome 1; Leopard Syndrome 3; Lung Cancer; Noonan Syndrome 1; Noonan Syndrome 7

Similar Products

Product Notes

The BRAF braf (Catalog #AAA140566) is a Recombinant Protein produced from E. coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MGSSHHH HHH SSGLVPRGSH MGSEF SEDRNRMKTL GRRDSSDDWE IPDGQITVGQ RIGSGSFGTV YKGKWHGDVA VKMLNVTAPT PQQLQAFKNE VGVLRKTRHV NILLFMGYST KPQLAIVTQW CEGSSLYHHL HIIETKFEMI KLIDIARQTA QGMDYLHAKS IIHRDLKSNN IFLHEDLTVK IGDFGLATVK SRWSGSHQFE QLSGSILWMA PEVIRMQDKN PYSFQSDVYA FGIVLYELMT GQLPYSNINN RDQIIFMVGR GYLSPDLSKV RSNCPKAMKR LMAECLKKKR DERPLFPQIL ASIELLARSL PKIHRSASEP SLNRAGFQTE DFSLYACASP KTPIQAGGYG AFPVH. It is sometimes possible for the material contained within the vial of "B-Raf Proto-Oncogene, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.