Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Bcl-2-modifying factor (BMF) Recombinant Protein | BMF recombinant protein

Recombinant Human Bcl-2-modifying factor (BMF)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Bcl-2-modifying factor (BMF); Recombinant Human Bcl-2-modifying factor (BMF); Bcl-2-modifying factor; BMF recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-184aa; Full Length of BC069505
Sequence
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSPGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNGAGPR
Sequence Length
184
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for BMF recombinant protein
May play a role in apoptosis. Isoform 1 seems to be the main initiator.
Product Categories/Family for BMF recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47.5 kDa
NCBI Official Full Name
bcl-2-modifying factor isoform bmf-1
NCBI Official Synonym Full Names
Bcl2 modifying factor
NCBI Official Symbol
BMF
NCBI Protein Information
bcl-2-modifying factor
UniProt Protein Name
Bcl-2-modifying factor
Protein Family
UniProt Gene Name
BMF
UniProt Entry Name
BMF_HUMAN

NCBI Description

The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein contains a single BCL2 homology domain 3 (BH3), and has been shown to bind BCL2 proteins and function as an apoptotic activator. This protein is found to be sequestered to myosin V motors by its association with dynein light chain 2, which may be important for sensing intracellular damage and triggering apoptosis. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

BMF: May play a role in apoptosis. Isoform 1 seems to be the main initiator. Interacts with MCL1, BCL2, BCL2L1/BCL-Xl, BCL2A1 and BCL2L2/BCL-w. Interacts with the myosin V actin motor complex through its binding to DLC2. Isoform 1 is mainly expressed in B-lymphoid cells. Isoform 2 and isoform 3 are mainly expressed in B-CLL and normal B-cells. Belongs to the Bcl-2 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytoskeletal; Apoptosis

Chromosomal Location of Human Ortholog: 15q14

Cellular Component: mitochondrial outer membrane; plasma membrane; acrosome; myosin complex; cytosol

Molecular Function: protein binding

Biological Process: apoptosis; positive regulation of protein homooligomerization; anoikis

Research Articles on BMF

Similar Products

Product Notes

The BMF bmf (Catalog #AAA1288592) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-184aa; Full Length of BC069505. The amino acid sequence is listed below: MEPSQCVEEL EDDVFQPEDG EPVTQPGSLL SADLFAQSLL DCPLSRLQLF PLTHCCGPGL RPTSQEDKAT QTLSPASPSP GVMLPCGVTE EPQRLFYGNA GYRLPLPASF PAVLPIGEQP PEGQWQHQAE VQIARKLQCI ADQFHRLHVQ QHQQNQNRVW WQILLFLHNL ALNGEENRNG AGPR. It is sometimes possible for the material contained within the vial of "Bcl-2-modifying factor (BMF), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.