Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Biliverdin reductase A (BLVRA) Recombinant Protein | BLVRA recombinant protein

Recombinant Human Biliverdin reductase A (BLVRA)

Gene Names
BLVRA; BVR; BLVR; BVRA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Biliverdin reductase A (BLVRA); Recombinant Human Biliverdin reductase A (BLVRA); Biliverdin reductase A; BVR A; EC=1.3.1.24; Biliverdin-IX alpha-reductase; BLVRA recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-296. Full Length
Sequence
MNAEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

Related Product Information for BLVRA recombinant protein
Reduces the gamma-methene bridge of the open tetrapyrrole, biliverdin IX alpha, to bilirubin with the concomitant oxidation of a NADH or NADPH cofactor.
Product Categories/Family for BLVRA recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
644
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60.4 kDa
NCBI Official Full Name
biliverdin reductase A
NCBI Official Synonym Full Names
biliverdin reductase A
NCBI Official Symbol
BLVRA
NCBI Official Synonym Symbols
BVR; BLVR; BVRA
NCBI Protein Information
biliverdin reductase A; BVR A; biliverdin-IX alpha-reductase
UniProt Protein Name
Biliverdin reductase A
Protein Family
UniProt Gene Name
BLVRA
UniProt Synonym Gene Names
BLVR; BVR; BVR A
UniProt Entry Name
BIEA_HUMAN

NCBI Description

The protein encoded by this gene belongs to the biliverdin reductase family, members of which catalyze the conversion of biliverdin to bilirubin in the presence of NADPH or NADH. Mutations in this gene are associated with hyperbiliverdinemia. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

BVR: Reduces the gamma-methene bridge of the open tetrapyrrole, biliverdin IX alpha, to bilirubin with the concomitant oxidation of a NADH or NADPH cofactor. Monomer. Liver. Belongs to the Gfo/Idh/MocA family. Biliverdin reductase subfamily.

Protein type: Kinase, protein; EC 1.3.1.24; Protein kinase, Ser/Thr (non-receptor); Oxidoreductase; Cofactor and Vitamin Metabolism - porphyrin and chlorophyll; ATYPICAL group; BLVRA family

Chromosomal Location of Human Ortholog: 7p13

Cellular Component: cytosol

Molecular Function: zinc ion binding; biliverdin reductase activity

Biological Process: heme catabolic process; porphyrin metabolic process

Disease: Hyperbiliverdinemia

Research Articles on BLVRA

Similar Products

Product Notes

The BLVRA blvra (Catalog #AAA967861) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-296. Full Length. The amino acid sequence is listed below: MNAEPERKFG VVVVGVGRAG SVRMRDLRNP HPSSAFLNLI GFVSRRELGS IDGVQQISLE DALSSQEVEV AYICSESSSH EDYIRQFLNA GKHVLVEYPM TLSLAAAQEL WELAEQKGKV LHEEHVELLM EEFAFLKKEV VGKDLLKGSL LFTAGPLEEE RFGFPAFSGI SRLTWLVSLF GELSLVSATL EERKEDQYMK MTVCLETEKK SPLSWIEEKG PGLKRNRYLS FHFKSGSLEN VPNVGVNKNI FLKDQNIFVQ KLLGQFSEKE LAAEKKRILH CLGLAEEIQK YCCSRK . It is sometimes possible for the material contained within the vial of "Biliverdin reductase A (BLVRA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual