Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

E2F1 blocking peptide

E2F1 Peptide

Gene Names
E2F1; RBP3; E2F-1; RBAP1; RBBP3
Applications
Immunocompetition, Immunodepletion
Synonyms
E2F1; E2F1 Peptide; DmelCG6376; drosE2F1; E(Sev-CycE)3A; E(var)3-93E; E2-promoter binding facto; E2F 1; E2f-PA; E2f-PB; E2f-PC; KIAA4009; l(3)07172; l(3)j3B1; l(3)j3C2; l(3)rM729; mKIAA4009; PBR3; PRB binding protein E2F 1; RBAP1; RBBP 3; Retinoblastoma associated protein 1; Retinoblastoma binding protein 3; Transcription factor E2F1 antibody; E2F1 blocking peptide
Ordering
For Research Use Only!
Form/Format
Antigenic Blocking Peptide
Concentration
Quantity: 250 ug; Volume: 100 ul (varies by lot)
Sequence Length
437
Applicable Applications for E2F1 blocking peptide
Immunocompetition, Immunodepletion
Application Notes
Western Blot: 1:1,000
Immunogen
Synthetic peptide corresponding to amino acids 58-93 of Human E2F1.
Sequence: PCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLD
Determinant
N-epitope
Molecular Function
DNA-binding; Apoptosis
Structure
Component of DRTF1/E2F transcription factor complex. Forms heterodimers with DP family members.
Subcellular Location
Nucleus
Preparation and Storage
-20 degree C for long term storage
Related Product Information for E2F1 blocking peptide
Antigenic Blocking Peptide E2F transcription factor 1 Antibody N-epitope
Transcription activator that binds DNA cooperatively with DP proteins through E2 recognition site

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46,920 Da
NCBI Official Full Name
Transcription factor E2F1
NCBI Official Synonym Full Names
E2F transcription factor 1
NCBI Official Symbol
E2F1
NCBI Official Synonym Symbols
RBP3; E2F-1; RBAP1; RBBP3
NCBI Protein Information
transcription factor E2F1
UniProt Protein Name
Transcription factor E2F1
Protein Family
UniProt Gene Name
E2F1
UniProt Synonym Gene Names
RBBP3; E2F-1; RBAP-1; RBBP-3
UniProt Entry Name
E2F1_HUMAN

NCBI Description

The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F2 and E2F3, have an additional cyclin binding domain. This protein binds preferentially to retinoblastoma protein pRB in a cell-cycle dependent manner. It can mediate both cell proliferation and p53-dependent/independent apoptosis. [provided by RefSeq, Jul 2008]

Uniprot Description

E2F1: a member of the E2F/DP family of transcription factors.The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. Binds DNA cooperatively with Dp transcription factors in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication.The Dp-1/E2F complex functions in the control of cell-cycle progression from G1 to S phase. The E2F-1 complex binds specifically hypophosphorylated retinoblastoma protein RB1. During the cell cycle, RB1 becomes phosphorylated in mid-to-late G1 phase, detaches from the DRTF1/E2F complex, rendering E2F transcriptionally active. Phosphorylated by CDK2 and cyclin A-CDK2 in the S-phase. It can mediate both cell proliferation and p53-dependent apoptosis.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 20q11.2

Cellular Component: mitochondrion; nuclear chromatin; nucleoplasm; nucleus; Rb-E2F complex

Molecular Function: DNA binding; protein binding; protein kinase binding; sequence-specific DNA binding; transcription factor activity; transcription factor binding

Biological Process: anoikis; DNA damage checkpoint; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest; DNA damage response, signal transduction resulting in induction of apoptosis; forebrain development; mRNA stabilization; negative regulation of DNA binding; negative regulation of fat cell differentiation; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; positive regulation of fibroblast proliferation; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; regulation of transcription, DNA-dependent; spermatogenesis; transcription, DNA-dependent

Research Articles on E2F1

Similar Products

Product Notes

The E2F1 e2f1 (Catalog #AAA543607) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's E2F1 can be used in a range of immunoassay formats including, but not limited to, Immunocompetition, Immunodepletion. Western Blot: 1:1,000. Researchers should empirically determine the suitability of the E2F1 e2f1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "E2F1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.