Malonyl-CoA O-methyltransferase BioC (bioC) Recombinant Protein | bioC recombinant protein

Recombinant Acinetobacter sp. Malonyl-CoA O-methyltransferase BioC (bioC)

Cat. Num. AAA1324294

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Malonyl-CoA O-methyltransferase BioC (bioC); Recombinant Acinetobacter sp. Malonyl-CoA O-methyltransferase BioC (bioC); bioC recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-255, Full length
• Sequence: MFVNLNKSLIAQRFAKARQSYVENAIAQKKISHHLCHLMQAYCPLHLSRIFEIGCGSGNLTQELFVSFQIQRAYLNDLYDEVKQHFLDEQPIEWCIGDIESLSLPEHLNAIVSSSAIQWVQNLPQLLGRCHHALNDQGWLCLSTFGSDNFKEIKQLTGQGLSYWSVQDWQVHLQASGFELMKIEQQQLKMQFDSPRAILKHLKATGVTGTVATTQPHWNKQSLAQFYHDYCQFQTDDGHYELTYHPIYIIARRTS
• Sequence Length: 255

• Species: Acinetobacter sp. (strain ADP1)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 81393594
• UniProt Accession #: Q6FDV0
• Molecular Weight: 29,425 Da
• NCBI Official Full Name: Malonyl-[acyl-carrier protein] O-methyltransferase
• UniProt Protein Name: Malonyl-[acyl-carrier protein] O-methyltransferase
• Protein Family: Malonyl-[acyl-carrier protein] O-methyltransferase
• UniProt Gene Name: bioC
• UniProt Synonym Gene Names: Malonyl-ACP O-methyltransferase

Uniprot Description

Converts the free carboxyl group of a malonyl-thioester to its methyl ester by transfer of a methyl group from S-adenosyl-L-methionine (SAM). It allows to synthesize pimeloyl-ACP via the fatty acid synthetic pathway.