BGP recombinant protein

Recombinant Human Osteocalcin/Bone gla protein (OTB/GP) Protein

Cat. Num. AAA286148

• Gene Names: BGLAP; OC; BGP; OCN
• Purity: > 90 % as determined by SDS-PAGE.
• Synonyms: BGP; Recombinant Human Osteocalcin/Bone gla protein (OTB/GP) Protein; OC; BGLAP; OT; Bone Gla Protein; Bone Gamma-Carboxyglutamate Protein; Gamma-carboxyglutamic acid-containing protein.; BGP recombinant protein

• Host: E. coli
• Purity/Purification: > 90 % as determined by SDS-PAGE.
• Form/Format: Lyophilized powder; Lyophilized from 10mM Tris-HCl, 1mM EDTA, 6% Trehalose, pH 8.0. The volume before lyophilized is 100uL/ vial
• Concentration: 0.3 mg/mL (varies by lot)
• Sequence Positions: 52-94
• Sequence: YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYR

• Source: Human
• Residues: N-terminal GST-tagged.
• Usage: We recommedend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1mg/ml. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long term storage at -20°C to -80°C. Our default final concentration of glycerol is 50%.
• Preparation and Storage: Short Term: -20°C; Long Term: -80°C; Recommended to aliquot the protein into smaller quantities for optimal storage.

SDS-PAGE

Related Product Information for BGP recombinant protein

Osteocalcin (OC) is the most abundant noncollagenous protein in mature bone where it constitutes 1% to 2% of the total protein. Synthesized by osteoblasts, it is incorporated into the bone matrix. Osteocalcin is a 49-residue protein with three gamma-carboxyglutamic acid residues, at positions 17, 21 and 24. These three residues confer on it a very strong ability to bind to hydroxyapatite. Osteocalcin is a noncollagenous protein found in bone and dentin. It is secreted by osteoblasts and thought to play a role in mineralization and calcium ion homeostasis. It has been stipulated that osteocalcin may also function as a negative regulator of bone formation, although its exact role is unknown.

NCBI and Uniprot Product Information

• NCBI GI #: 40316933
• NCBI GeneID: 632
• NCBI Accession #: NP_954642.1
• NCBI GenBank Nucleotide #: NM_199173.5
• UniProt Accession #: P02818; Q5TCK6
• Molecular Weight: Predicted MW: 32.5 kDa; Observed MW: 32 kDa
• NCBI Official Full Name: osteocalcin preproprotein
• NCBI Official Synonym Full Names: bone gamma-carboxyglutamate protein
• NCBI Official Symbol: BGLAP
• NCBI Official Synonym Symbols: OC; BGP; OCN
• NCBI Protein Information: osteocalcin
• UniProt Protein Name: Osteocalcin
• UniProt Gene Name: BGLAP
• UniProt Synonym Gene Names: BGP
• UniProt Entry Name: OSTCN_HUMAN

NCBI Description

This gene encodes a highly abundant bone protein secreted by osteoblasts that regulates bone remodeling and energy metabolism. The encoded protein contains a Gla (gamma carboxyglutamate) domain, which functions in binding to calcium and hydroxyapatite, the mineral component of bone. Serum osteocalcin levels may be negatively correlated with metabolic syndrome. Read-through transcription exists between this gene and the neighboring upstream gene, PMF1 (polyamine-modulated factor 1), but the encoded protein only shows sequence identity with the upstream gene product. [provided by RefSeq, Jun 2015]

Uniprot Description

osteocalcin: Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium. Belongs to the osteocalcin/matrix Gla protein family.

Protein type: Cell development/differentiation; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 1q22

Cellular Component: cytoplasm; endoplasmic reticulum lumen; Golgi lumen

Biological Process: ER to Golgi vesicle-mediated transport; osteoblast differentiation; peptidyl-glutamic acid carboxylation; response to vitamin D; signal peptide processing; skeletal development