Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

BET1 homolog Recombinant Protein | Bet1 recombinant protein

BET1 homolog

Gene Names
Bet1; Bet-1; AW555236
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
BET1 homolog; Bet1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-118aa; full length protein
Sequence
MRRAGLGDGAPPGSYGNYGYANTGYNACEEENDRLTESLRSKVTAIKSLSIEIGHEVKNQNKLLAEMDSQFDSTTGFLGKTMGRLKILSRGSQTKLLCYMMLFSLFVFFVIYWIIKLR
Sequence Length
Full Length Protein
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Bet1 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for Bet1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13,274 Da
NCBI Official Full Name
BET1 homolog
NCBI Official Synonym Full Names
Bet1 golgi vesicular membrane trafficking protein
NCBI Official Symbol
Bet1
NCBI Official Synonym Symbols
Bet-1; AW555236
NCBI Protein Information
BET1 homolog
UniProt Protein Name
BET1 homolog
Protein Family
UniProt Gene Name
Bet1
UniProt Synonym Gene Names
mBET1
UniProt Entry Name
BET1_MOUSE

Uniprot Description

BET1: Required for vesicular transport from the ER to the Golgi complex. Functions as a SNARE involved in the docking process of ER-derived vesicles with the cis-Golgi membrane. Belongs to the BET1 family.

Protein type: Membrane protein, integral; Vesicle

Cellular Component: cis-Golgi network; Golgi cisterna; Golgi membrane; integral to membrane; membrane; SNARE complex

Molecular Function: syntaxin binding

Biological Process: ER to Golgi vesicle-mediated transport; vesicle fusion with Golgi apparatus; vesicle-mediated transport

Similar Products

Product Notes

The Bet1 bet1 (Catalog #AAA7042356) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-118aa; full length protein. The amino acid sequence is listed below: MRRAGLGDGA PPGSYGNYGY ANTGYNACEE ENDRLTESLR SKVTAIKSLS IEIGHEVKNQ NKLLAEMDSQ FDSTTGFLGK TMGRLKILSR GSQTKLLCYM MLFSLFVFFV IYWIIKLR. It is sometimes possible for the material contained within the vial of "BET1 homolog, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.