Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

B1 bradykinin receptor (Bdkrb1) Recombinant Protein | Bdkrb1 recombinant protein

Recombinant Rat B1 bradykinin receptor (Bdkrb1)

Gene Names
Bdkrb1; BKR; Bdkrb; b1bkr
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
B1 bradykinin receptor (Bdkrb1); Recombinant Rat B1 bradykinin receptor (Bdkrb1); Recombinant B1 bradykinin receptor (Bdkrb1); B1 bradykinin receptor; B1R; BK-1 receptor; Kinin B1 receptor; KB1; Bdkrb1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-337
Sequence
MASEVLLELQPSNRSLQAPANITSCESALEDWDLLYRVLPGFVITICFFGLLGNLLVLSFFLLPWRQWWWQQRQRQQRLTIAEIYLANLAASDLVFVLGLPFWAENIGNRFNWPFGTDLCRVVSGVIKANLFVSIFLVVAISQDRYRLLVYPMTSWGYRRRRQAQATCLLIWVAGGLLSIPTFLLRSVKVVPDLNVSACILLFPHEAWHFARMVELNVLGFLLPVTAIIFFNYHILASLRGQKEASRTRCGGPKGSKTTGLILTLVASFLVCWCPYHFFAFLDFLVQVRVIQDCSWKEITDLGLQLANFFAFVNSCLNPLIYVFAGRLLKTRVLGTL
Sequence Length
337
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,378 Da
NCBI Official Full Name
B1 bradykinin receptor
NCBI Official Synonym Full Names
bradykinin receptor B1
NCBI Official Symbol
Bdkrb1
NCBI Official Synonym Symbols
BKR; Bdkrb; b1bkr
NCBI Protein Information
B1 bradykinin receptor; B1R; KB1; BK-1 receptor; kinin B1 receptor; bradykinin B1 receptor; bradykinin receptor, beta 1
UniProt Protein Name
B1 bradykinin receptor
Protein Family
UniProt Gene Name
Bdkrb1
UniProt Synonym Gene Names
B1bkr; Bkr; B1R; BK-1 receptor; KB1
UniProt Entry Name
BKRB1_RAT

NCBI Description

may play a role in regulation of inflammatory response [RGD, Feb 2006]

Uniprot Description

BKR1: This is a receptor for bradykinin. Could be a factor in chronic pain and inflammation. Belongs to the G-protein coupled receptor 1 family. Bradykinin receptor subfamily. BDKRB1 sub-subfamily.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; GPCR, family 1; Receptor, GPCR

Cellular Component: neuron projection; membrane; integral to membrane; plasma membrane

Molecular Function: bradykinin receptor activity; peptide binding

Biological Process: G-protein coupled receptor protein signaling pathway; cell migration; negative regulation of protein amino acid phosphorylation; response to mechanical stimulus; positive regulation of leukocyte migration; protein kinase C activation; response to lipopolysaccharide; negative regulation of cell growth; positive regulation of release of sequestered calcium ion into cytosol; negative regulation of blood pressure; inflammatory response; sensory perception of pain

Research Articles on Bdkrb1

Similar Products

Product Notes

The Bdkrb1 bdkrb1 (Catalog #AAA1112408) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-337. The amino acid sequence is listed below: MASEVLLELQ PSNRSLQAPA NITSCESALE DWDLLYRVLP GFVITICFFG LLGNLLVLSF FLLPWRQWWW QQRQRQQRLT IAEIYLANLA ASDLVFVLGL PFWAENIGNR FNWPFGTDLC RVVSGVIKAN LFVSIFLVVA ISQDRYRLLV YPMTSWGYRR RRQAQATCLL IWVAGGLLSI PTFLLRSVKV VPDLNVSACI LLFPHEAWHF ARMVELNVLG FLLPVTAIIF FNYHILASLR GQKEASRTRC GGPKGSKTTG LILTLVASFL VCWCPYHFFA FLDFLVQVRV IQDCSWKEIT DLGLQLANFF AFVNSCLNPL IYVFAGRLLK TRVLGTL. It is sometimes possible for the material contained within the vial of "B1 bradykinin receptor (Bdkrb1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.