Bcl-2-like protein 11 Recombinant Protein | BCL2L11 recombinant protein

Recombinant Human Bcl-2-like protein 11

Cat. Num. AAA1094348

• Gene Names: BCL2L11; BAM; BIM; BOD
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Bcl-2-like protein 11; Recombinant Human Bcl-2-like protein 11; Bcl2-interacting mediator of cell death; BCL2L11 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-198aa; Full Length
• Sequence: MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH
• Sequence Length: 198

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for BCL2L11 recombinant protein

Induces apoptosis and anoikis. Isoform BimL is more potent than isoform BimEL. Isoform Bim-alpha1, isoform Bim-alpha2 and isoform Bim-alpha3 induce apoptosis, although less potent than isoform BimEL, isoform BimL and isoform BimS. Isoform Bim-gamma induces apoptosis. Isoform Bim-alpha3 induces apoptosis possibly through a caspase-mediated pathway. Isoform BimAC and isoform BimABC lack the ability to induce apoptosis.

Product Categories/Family for BCL2L11 recombinant protein

Cancer

References

Bim a novel member of the Bcl-2 family that promotes apoptosis.O'Connor L., Strasser A., O'Reilly L.A., Hausmann G., Adams J.M., Cory S., Huang D.C.S.EMBO J. 17:384-395(1998) Molecular cloning and characterization of six novel isoforms of human Bim, a member of the proapoptotic Bcl-2 family.Mami U., Miyashita T., Shikama Y., Tadokoro K., Yamada M.FEBS Lett. 509:135-141(2001) Identification and characterization of Bimgamma, a novel proapoptotic BH3-only splice variant of Bim.Liu J.-W., Chandra D., Tang S.H., Chopra D., Tang D.G.Cancer Res. 62:2976-2981(2002) Identification of novel isoforms of the BH3 domain protein Bim which directly activate Bax to trigger apoptosis.Marani M., Tenev T., Hancock D., Downward J., Lemoine N.R.Mol. Cell. Biol. 22:3577-3589(2002) Over-expression of Bim alpha3, a novel isoform of human Bim, result in cell apoptosis.Chen J.Z., Ji C.N., Gu S.H., Li J.X., Zhao E.P., Huang Y., Huang L., Ying K., Xie Y., Mao Y.M.Int. J. Biochem. Cell Biol. 36:1554-1561(2004) Identification and characterization of BH3 domain protein Bim and its isoforms in human hepatocellular carcinomas.Miao J., Chen G.G., Yun J.P., Chun S.Y., Zheng Z.Z., Ho R.L.K., Chak E.C., Xia N.S., Lai P.B.Apoptosis 12:1691-1701(2007) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) Generation and annotation of the DNA sequences of human chromosomes 2 and 4.Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.Nature 434:724-731(2005)

NCBI and Uniprot Product Information

• NCBI GI #: 323362959
• NCBI GeneID: 10018
• NCBI Accession #: NP_001191035.1
• NCBI GenBank Nucleotide #: NM_001204106.1
• UniProt Accession #: O43521; O43522; Q0MSE7; Q0MSE8; Q0MSE9; Q53R28; Q6JTU6; Q6T851; Q6TE14; Q6TE15; Q6TE16; A8K2W2
• Molecular Weight: 24.2 kDa
• NCBI Official Full Name: bcl-2-like protein 11 isoform 11
• NCBI Official Synonym Full Names: BCL2 like 11
• NCBI Official Symbol: BCL2L11
• NCBI Official Synonym Symbols: BAM; BIM; BOD
• NCBI Protein Information: bcl-2-like protein 11
• UniProt Protein Name: Bcl-2-like protein 11
• Protein Family: Bcl-2-like protein
• UniProt Gene Name: BCL2L11
• UniProt Synonym Gene Names: BIM; Bcl2-L-11
• UniProt Entry Name: B2L11_HUMAN

NCBI Description

The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The protein encoded by this gene contains a Bcl-2 homology domain 3 (BH3). It has been shown to interact with other members of the BCL-2 protein family and to act as an apoptotic activator. The expression of this gene can be induced by nerve growth factor (NGF), as well as by the forkhead transcription factor FKHR-L1, which suggests a role of this gene in neuronal and lymphocyte apoptosis. Transgenic studies of the mouse counterpart suggested that this gene functions as an essential initiator of apoptosis in thymocyte-negative selection. Several alternatively spliced transcript variants of this gene have been identified. [provided by RefSeq, Jun 2013]

Uniprot Description

BIM: a pro-apoptotic member of the BCL-2 protein family. Interacts with other members of the BCL-2 protein family, including BCL2, BCL2L1/BCL-X(L), and MCL1, and act as an apoptotic activator. Its expression can be induced by nerve growth factor (NGF), as well as by the forkhead transcription factor FKHR-L1, which suggests a role in neuronal and lymphocyte apoptosis. Transgenic studies in the mouse suggested that this protein functions as an essential initiator of the apoptosis in thymocyte-negative selection. Nineteen alternatively spliced transcript variants of this gene have been reported.

Protein type: Apoptosis

Chromosomal Location of Human Ortholog: 2q13

Cellular Component: cytosol; endomembrane system; extrinsic to membrane; microtubule; mitochondrial outer membrane; mitochondrion

Molecular Function: microtubule binding; protein binding

Biological Process: apoptosis; B cell apoptosis; B cell homeostasis; brain development; caspase activation; cell-matrix adhesion; cellular process regulating host cell cycle in response to virus; DNA damage response, signal transduction resulting in induction of apoptosis; ear development; in utero embryonic development; kidney development; lumen formation; male gonad development; mammary gland development; meiosis I; myeloid cell homeostasis; nerve growth factor receptor signaling pathway; odontogenesis of dentine-containing teeth; pigmentation during development; positive regulation of apoptosis; positive regulation of apoptosis by virus; positive regulation of caspase activity; positive regulation of cell cycle; positive regulation of neuron apoptosis; positive regulation of protein homooligomerization; post-embryonic organ morphogenesis; programmed cell death; regulation of organ growth; regulation of pigmentation during development; spermatogenesis; spleen development; T cell homeostasis; thymus development