Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human BCL2 was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 25 kDa.)

BCL2 recombinant protein

Recombinant Human BCL2 Protein

Gene Names
BCL2; Bcl-2; PPP1R50
Purity
> 95% by SDS-PAGE.
Synonyms
BCL2; Recombinant Human BCL2 Protein; Bcl-2; PPP1R50; BCL2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
> 95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 muM filtered solution of 20mM Tris, 200mM NaCl, 30% Glycerol, 1mMDTT, pH 8.0.
Sequence
AHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFD
Sequence Length
239
Species
Human
Tag
No tag
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Protein Construction
High quality, high purity and low endotoxin recombinant Recombinant Human BCL2 Protein (RP00062), tested reactivity in Human and has been validated in SDS-PAGE.100% guaranteed.
Preparation and Storage
Store the lyophilized protein at-20 degree C to-80 degree C for long term.
After reconstitution, the protein solution is stable at-20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human BCL2 was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 25 kDa.)

SDS-Page (Recombinant Human BCL2 was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 25 kDa.)
Related Product Information for BCL2 recombinant protein
Description: Recombinant Human BCL2 Protein is produced by e coli expression system. The target protein is expressed with sequence (Ala2-Asp211) of human BCL2 (Accession #NP_000624.2).
Background: This protein is an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
596
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,337 Da
NCBI Official Full Name
apoptosis regulator Bcl-2 isoform alpha
NCBI Official Synonym Full Names
BCL2, apoptosis regulator
NCBI Official Symbol
BCL2
NCBI Official Synonym Symbols
Bcl-2; PPP1R50
NCBI Protein Information
apoptosis regulator Bcl-2
UniProt Protein Name
Apoptosis regulator Bcl-2
UniProt Gene Name
BCL2

NCBI Description

This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]

Uniprot Description

Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). May attenuate inflammation by impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release (PubMed:17418785).

Research Articles on BCL2

Similar Products

Product Notes

The BCL2 bcl2 (Catalog #AAA9139665) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: AHAGRTGYDN REIVMKYIHY KLSQRGYEWD AGDVGAAPPG AAPAPGIFSS QPGHTPHPAA SRDPVARTSP LQTPAAPGAA AGPALSPVPP VVHLTLRQAG DDFSRRYRRD FAEMSSQLHL TPFTARGRFA TVVEELFRDG VNWGRIVAFF EFGGVMCVES VNREMSPLVD NIALWMTEYL NRHLHTWIQD NGGWDAFVEL YGPSMRPLFD. It is sometimes possible for the material contained within the vial of "BCL2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.