Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Apoptosis regulator Bcl-2 (BCL2) Recombinant Protein | BCL2 recombinant protein

Recombinant Human Apoptosis regulator Bcl-2 (BCL2)

Gene Names
BCL2; Bcl-2; PPP1R50
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Apoptosis regulator Bcl-2 (BCL2); Recombinant Human Apoptosis regulator Bcl-2 (BCL2); Recombinant Apoptosis regulator Bcl-2 (BCL2); Apoptosis regulator Bcl-2; BCL2 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-239
Sequence
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
Sequence Length
239
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
596
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,266 Da
NCBI Official Full Name
apoptosis regulator Bcl-2 alpha isoform
NCBI Official Synonym Full Names
B-cell CLL/lymphoma 2
NCBI Official Symbol
BCL2
NCBI Official Synonym Symbols
Bcl-2; PPP1R50
NCBI Protein Information
apoptosis regulator Bcl-2; protein phosphatase 1, regulatory subunit 50
UniProt Protein Name
Apoptosis regulator Bcl-2
Protein Family
UniProt Gene Name
BCL2
UniProt Entry Name
BCL2_HUMAN

NCBI Description

This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma. Two transcript variants, produced by alternate splicing, differ in their C-terminal ends. [provided by RefSeq, Jul 2008]

Uniprot Description

Bcl-2: a antiapoptotic member of the Bcl-2 family. Regulates cell death by controlling the mitochondrial membrane permeability. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). Phosphorylation by JNKs may increase its antiapoptotic functions.

Protein type: Autophagy; Apoptosis; Oncoprotein; Membrane protein, integral

Chromosomal Location of Human Ortholog: 18q21.3

Cellular Component: pore complex; endoplasmic reticulum membrane; mitochondrial outer membrane; nuclear membrane; mitochondrion; membrane; endoplasmic reticulum; cytoplasm; nucleus; cytosol; myelin sheath

Molecular Function: identical protein binding; protein binding; protein homodimerization activity; protease binding; protein phosphatase 2A binding; protein heterodimerization activity; channel activity; sequence-specific DNA binding; ubiquitin protein ligase binding; BH3 domain binding; channel inhibitor activity; transcription factor binding

Biological Process: response to nicotine; focal adhesion formation; positive regulation of catalytic activity; developmental growth; renal system process; protein polyubiquitination; pigment granule organization and biogenesis; response to toxin; response to glucocorticoid stimulus; T cell differentiation in the thymus; ear development; lymphoid progenitor cell differentiation; female pregnancy; positive regulation of multicellular organism growth; glomerulus development; negative regulation of mitochondrial depolarization; post-embryonic development; cochlear nucleus development; cellular response to glucose starvation; negative regulation of myeloid cell apoptosis; B cell receptor signaling pathway; regulation of mitochondrial membrane potential; positive regulation of B cell proliferation; negative regulation of ossification; regulation of transmembrane transporter activity; T cell homeostasis; negative regulation of neuron apoptosis; cell growth; defense response to virus; spleen development; response to drug; positive regulation of neuron maturation; release of cytochrome c from mitochondria; axon regeneration; regulation of protein homodimerization activity; cell aging; actin filament organization; digestive tract morphogenesis; regulation of calcium ion transport; positive regulation of cell growth; organ growth; induction of apoptosis via death domain receptors; DNA damage response, signal transduction resulting in induction of apoptosis; gland morphogenesis; negative regulation of osteoblast proliferation; regulation of mitochondrial membrane permeability; regulation of nitrogen utilization; metanephros development; oocyte development; negative regulation of apoptosis; B cell proliferation; negative regulation of autophagy; regulation of protein heterodimerization activity; behavioral fear response; melanin metabolic process; negative regulation of retinal cell programmed cell death; apoptosis; regulation of cell-matrix adhesion; regulation of protein stability; positive regulation of smooth muscle cell migration; protein amino acid dephosphorylation; response to radiation; positive regulation of skeletal muscle fiber development; B cell homeostasis; ovarian follicle development; positive regulation of melanocyte differentiation; melanocyte differentiation; response to gamma radiation; negative regulation of cell migration; response to iron ion; transmembrane transport; regulation of viral genome replication; negative regulation of cellular pH reduction; mesenchymal cell development; ossification; CD8-positive, alpha-beta T cell lineage commitment; hair follicle morphogenesis; thymus development; B cell lineage commitment; male gonad development; peptidyl-threonine phosphorylation; positive regulation of peptidyl-serine phosphorylation; humoral immune response; response to UV-B; endoplasmic reticulum calcium ion homeostasis; peptidyl-serine phosphorylation; neuron apoptosis; axonogenesis; response to hydrogen peroxide; homeostasis of number of cells within a tissue; ureteric bud branching; response to cytokine stimulus; innate immune response; negative regulation of cell growth; response to DNA damage stimulus; induction of apoptosis by oxidative stress

Research Articles on BCL2

Similar Products

Product Notes

The BCL2 bcl2 (Catalog #AAA955642) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-239. The amino acid sequence is listed below: MAHAGRTGYD NREIVMKYIH YKLSQRGYEW DAGDVGAAPP GAAPAPGIFS SQPGHTPHPA ASRDPVARTS PLQTPAAPGA AAGPALSPVP PVVHLTLRQA GDDFSRRYRR DFAEMSSQLH LTPFTARGRF ATVVEELFRD GVNWGRIVAF FEFGGVMCVE SVNREMSPLV DNIALWMTEY LNRHLHTWIQ DNGGWDAFVE LYGPSMRPLF DFSWLSLKTL LSLALVGACI TLGAYLGHK. It is sometimes possible for the material contained within the vial of "Apoptosis regulator Bcl-2 (BCL2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.