SDS-PAGE
Pre-mRNA-splicing factor SPF27 (BCAS2) Recombinant Protein | BCAS2 recombinant protein
Recombinant Human Pre-mRNA-splicing factor SPF27 (BCAS2)
Gene Names
BCAS2; DAM1; SPF27; Snt309
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Pre-mRNA-splicing factor SPF27 (BCAS2); Recombinant Human Pre-mRNA-splicing factor SPF27 (BCAS2); Pre-mRNA-splicing factor SPF27; Breast carcinoma-amplified sequence 2; DNA amplified in mammary carcinoma 1 protein; Spliceosome-associated protein SPF 27; BCAS2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-225aa; Full Length
Sequence
AGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF
Sequence Length
224
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for BCAS2 recombinant protein
Component of the PRP19-CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing. May have a scaffolding role in the spliceosome assembly as it contacts all other components of the core complex. The PRP19-CDC5L complex may also play a role in the response to DNA damage (DDR).
Product Categories/Family for BCAS2 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
53 kDa
NCBI Official Full Name
pre-mRNA-splicing factor SPF27
NCBI Official Synonym Full Names
breast carcinoma amplified sequence 2
NCBI Official Symbol
BCAS2
NCBI Official Synonym Symbols
DAM1; SPF27; Snt309
NCBI Protein Information
pre-mRNA-splicing factor SPF27; breast carcinoma-amplified sequence 2; spliceosome-associated protein SPF 27; DNA amplified in mammary carcinoma 1 protein; spliceosome associated protein, amplified in breast cancer
UniProt Protein Name
Pre-mRNA-splicing factor SPF27
UniProt Gene Name
BCAS2
UniProt Synonym Gene Names
DAM1
UniProt Entry Name
SPF27_HUMAN
Uniprot Description
BCAS2: Component of the PRP19-CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing. May have a scaffolding role in the spliceosome assembly as it contacts all other components of the core complex. Belongs to the SPF27 family.
Protein type: RNA splicing; Spliceosome; Nuclear receptor co-regulator; Nucleolus
Chromosomal Location of Human Ortholog: 1p13.2
Cellular Component: nucleoplasm; spliceosome; DNA replication factor A complex; nucleolus; nucleus; cell junction
Molecular Function: protein binding
Biological Process: nuclear mRNA splicing, via spliceosome; RNA splicing, via transesterification reactions; RNA splicing; gene expression
Research Articles on BCAS2
Similar Products
Product Notes
The BCAS2 bcas2 (Catalog #AAA1211980) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-225aa; Full Length. The amino acid sequence is listed below: AGTGLVAGEV VVDALPYFDQ GYEAPGVREA AAALVEEETR RYRPTKNYLS YLTAPDYSAF ETDIMRNEFE RLAARQPIEL LSMKRYELPA PSSGQKNDIT AWQECVNNSM AQLEHQAVRI ENLELMSQHG CNAWKVYNEN LVHMIEHAQK ELQKLRKHIQ DLNWQRKNMQ LTAGSKLREM ESNWVSLVSK NYEIERTIVQ LENEIYQIKQ QHGEANKENI RQDF. It is sometimes possible for the material contained within the vial of "Pre-mRNA-splicing factor SPF27 (BCAS2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
