Beta-amylase 1, chloroplastic (BAM1) Recombinant Protein | BAM1 recombinant protein
Recombinant Arabidopsis thaliana Beta-amylase 1, chloroplastic (BAM1) , partial
Gene Names
BAM1; AtBAM1; beta-amylase 1; BETA-AMYLASE 7; BMY7; TR-BAMY
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Beta-amylase 1; chloroplastic (BAM1); Recombinant Arabidopsis thaliana Beta-amylase 1; partial; BAM1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
42-354. Partial
Sequence
AMNRNYKAHGTDPSPPMSPILGATRADLSVACKAFAVENGIGTIEEQRTYREGGIGGKKEGGGGVPVFVMMPLDSVTMGNTVNRRKAMKASLQALKSAGVEGIMIDVWWGLVEKESPGTYNWGGYNELLELAKKLGLKVQAVMSFHQCGGNVGDSVTIPLPQWVVEEVDKDPDLAYTDQWGRRNHEYISLGADTLPVLKGRTPVQCYADFMRAFRDNFKHLLGETIVEIQVGMGPAGELRYPSYPEQEGTWKFPGIGAFQCYDKYSLSSLKAAAETYGKPEWGSTGPTDAGHYNNWPEDTQFFKKEGGGWNSE
Sequence Length
354
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
36.3
NCBI Official Full Name
beta-amylase 1
NCBI Official Symbol
BAM1
NCBI Official Synonym Symbols
AtBAM1; beta-amylase 1; BETA-AMYLASE 7; BMY7; TR-BAMY
NCBI Protein Information
beta-amylase 1
UniProt Protein Name
Beta-amylase 1, chloroplastic
Protein Family
UniProt Gene Name
BAM1
UniProt Synonym Gene Names
BMY7; TRBAMY; TR-BAMY
NCBI Description
Encodes a chloroplast beta-amylase. Is necessary for leaf starch breakdown in the absence of BAM3.
Uniprot Description
Beta-amylase activity. Can use p-nitrophenyl maltopentaoside (PNPG5) as substrate only in reduced form. Can play a minor role in the starch degradation and maltose metabolism in chloroplasts during the night. More active on phosphorylated glucan. Interacts directly with starch or other alpha-1,4-glucan.
Research Articles on BAM1
Similar Products
Product Notes
The BAM1 bam1 (Catalog #AAA1295896) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 42-354. Partial. The amino acid sequence is listed below: AMNRNYKAHG TDPSPPMSPI LGATRADLSV ACKAFAVENG IGTIEEQRTY REGGIGGKKE GGGGVPVFVM MPLDSVTMGN TVNRRKAMKA SLQALKSAGV EGIMIDVWWG LVEKESPGTY NWGGYNELLE LAKKLGLKVQ AVMSFHQCGG NVGDSVTIPL PQWVVEEVDK DPDLAYTDQW GRRNHEYISL GADTLPVLKG RTPVQCYADF MRAFRDNFKH LLGETIVEIQ VGMGPAGELR YPSYPEQEGT WKFPGIGAFQ CYDKYSLSSL KAAAETYGKP EWGSTGPTDA GHYNNWPEDT QFFKKEGGGW NSE . It is sometimes possible for the material contained within the vial of "Beta-amylase 1, chloroplastic (BAM1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
