SDS-PAGE
DNA polymerase catalytic subunit Recombinant Protein | BALF5 recombinant protein
Recombinant Epstein-Barr virus DNA polymerase catalytic subunit
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
DNA polymerase catalytic subunit; Recombinant Epstein-Barr virus DNA polymerase catalytic subunit; BALF5 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-210aa; Partial
Sequence
MSGGLFYNPFLRPNKGLLKKPDKEYLRLIPKCFQTPGAAGVVDVRGPQPPLCFYQDSLTVVGGDEDGKGMWWRQRAQEGTARPEADTHGSPLDFHVYDILETVYTHEKCAVIPSDKQGYVVPCGIVIKLLGRRKADGASVCVNVFGQQAYFYASAPQGLDVEFAVLSALKASTFDRRTPCRVSVEKVTRRSIMGYGNHAGDYHKITLSHP
Sequence Length
1015
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for BALF5 recombinant protein
Replicates viral genomic DNA in the late phase of lytic infection, producing long concateric DNA. The replication complex is composed of six viral proteins: the DNA polymerase, processivity factor, primase, primase-associated factor, helicase, and ssDNA-binding protein.
References
Sequence analysis of the 17,166 base-pair EcoRI fragment C of B95-8 Epstein-Barr virus.Bankier A.T., Deininger P.L., Farrell P.J., Barrell B.G.Mol. Biol. Med. 1:21-45(1983)
DNA sequence and expression of the B95-8 Epstein-Barr virus genome.Baer R., Bankier A.T., Biggin M.D., Deininger P.L., Farrell P.J., Gibson T.J., Hatfull G., Hudson G.S., Satchwell S.C., Seguin C., Tuffnell P.S., Barrell B.G.Nature 310:207-211(1984)
A major DNA binding protein encoded by BALF2 open reading frame of Epstein-Barr virus (EBV)
forms a complex with other EBV DNA-binding proteins
DNAase, EA-D, and DNA polymerase.Zeng Y., Middeldorp J., Madjar J.J., Ooka T.Virology 239:285-295(1997)
The Epstein-Barr virus pol catalytic subunit physically interacts with the BBLF4-BSLF1-BBLF2/3 complex.Fujii K., Yokoyama N., Kiyono T., Kuzushima K., Homma M., Nishiyama Y., Fujita M., Tsurumi T.J. Virol. 74:2550-2557(2000)
Architecture of replication compartments formed during Epstein-Barr virus lytic replication.Daikoku T., Kudoh A., Fujita M., Sugaya Y., Isomura H., Shirata N., Tsurumi T.J. Virol. 79:3409-3418(2005)
A functional and structural basis for TCR cross-reactivity in multiple sclerosis.Lang H.L.E., Jacobsen H., Ikemizu S., Andersson C., Harlos K., Madsen L., Hjorth P., Sondergaard L., Svejgaard A., Wucherpfennig K., Stuart D.I., Bell J.I., Jones E.Y., Fugger L.Nat. Immunol. 3:940-943(2002)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
39.2 kDa
NCBI Official Full Name
DNA polymerase
NCBI Official Symbol
BALF5
NCBI Protein Information
DNA polymerase
UniProt Protein Name
DNA polymerase catalytic subunit
Protein Family
UniProt Gene Name
BALF5
UniProt Entry Name
DPOL_EBVB9
Uniprot Description
Replicates viral genomic DNA in the late phase of lytic infection, producing long concatemeric DNA. The replication complex is composed of six viral proteins: the DNA polymerase, processivity factor, primase, primase-associated factor, helicase, and ssDNA-binding protein.
Research Articles on BALF5
Similar Products
Product Notes
The BALF5 balf5 (Catalog #AAA1259589) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-210aa; Partial. The amino acid sequence is listed below: MSGGLFYNPF LRPNKGLLKK PDKEYLRLIP KCFQTPGAAG VVDVRGPQPP LCFYQDSLTV VGGDEDGKGM WWRQRAQEGT ARPEADTHGS PLDFHVYDIL ETVYTHEKCA VIPSDKQGYV VPCGIVIKLL GRRKADGASV CVNVFGQQAY FYASAPQGLD VEFAVLSALK ASTFDRRTPC RVSVEKVTRR SIMGYGNHAG DYHKITLSHP. It is sometimes possible for the material contained within the vial of "DNA polymerase catalytic subunit, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
