BAG family molecular chaperone regulator 4 (Bag4) Recombinant Protein | Bag4 recombinant protein

Recombinant Mouse BAG family molecular chaperone regulator 4 (Bag4)

Cat. Num. AAA1426027

• Gene Names: Bag4; SODD; 2410112I15Rik
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: BAG family molecular chaperone regulator 4 (Bag4); Recombinant Mouse BAG family molecular chaperone regulator 4 (Bag4); Bag4 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-457, full length protein
• Sequence: MSALRRSGYGPSDGPSYGRYYGPGGGDVPVHVPPPLYPPLRPEPPQPPVSWRGRGGAPAETTWPGEGAGGDGYYPSGGAWAEASRAGGGHQEQPPYPGYNSNYWNSVRPRAPYPGSYSVRPELQGQSLNSYANGAYGPPYPPGPGASTASYSGAYYVPGYTQSNYSTEVPNTYRSPGNSPTPMSRWMYSQQDCPTEAPPLRGQVPGYPASQNPGMTLPHYPYGDGNRAVPQSGGTGRPQDDAWASSAYGMGARYPWPSAAPSAPSAGSLYMTESASPWPGNSSPQPPPSPPPQQPKDPSYSYNPSGQGLSRHSFPCSVHQYESPGAVNNDNSDLLDSQVQYSAEPQLYGNASSEHPSNQVPSNNLPEECFSSDEGTPPSIKKIIHVLEKVQFLEQEVEEFVGKKTDKAYWLLEEMLTKELLELDSVETGGQDSVRQARKEAVCKIQAILEKLEKKGL
• Sequence Length: 457

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Bag4 recombinant protein

This protein is a member of the BAG1-related protein family. BAG1 is an anti-apoptotic protein that functions through interactions with a variety of cell apoptosis and growth related proteins including BCL-2, Raf-protein kinase, steroid hormone receptors, growth factor receptors and members of the heat shock protein 70 kDa family. This protein contains a BAG domain near the C-terminus, which could bind and inhibit the chaperone activity of Hsc70
Hsp70. This protein was found to be associated with the death domain of tumor necrosis factor receptor type 1 (TNF-R1) and death receptor-3 (DR3), and thereby negatively regulates downstream cell death signaling. The regulatory role of this protein in cell death was demonstrated in epithelial cells which undergo apoptosis while integrin mediated matrix contacts are lost.

NCBI and Uniprot Product Information

• NCBI GI #: 17975504
• NCBI GeneID: 67384
• NCBI Accession #: NP_080397.1
• NCBI GenBank Nucleotide #: NM_026121.3
• UniProt Accession #: Q8CI61; Q3TRL9; Q91VT5; Q9CWG2
• Molecular Weight: 49,095 Da
• NCBI Official Full Name: BAG family molecular chaperone regulator 4
• NCBI Official Synonym Full Names: BCL2-associated athanogene 4
• NCBI Official Symbol: Bag4
• NCBI Official Synonym Symbols: SODD; 2410112I15Rik
• NCBI Protein Information: BAG family molecular chaperone regulator 4
• UniProt Protein Name: BAG family molecular chaperone regulator 4
• Protein Family: BAG family molecular chaperone regulator
• UniProt Gene Name: Bag4
• UniProt Synonym Gene Names: Sodd; BAG-4

Uniprot Description

Inhibits the chaperone activity of HSP70/HSC70 by promoting substrate release. Prevents constitutive TNFRSF1A signaling (). Negative regulator of PRKN translocation to damaged mitochondria ().