Vasopressin V1a receptor Recombinant Protein | Avpr1a recombinant protein

Recombinant Rat Vasopressin V1a receptor

Cat. Num. AAA1265325

• Gene Names: Avpr1a; V1a; AVPR; V1aR
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Vasopressin V1a receptor; Recombinant Rat Vasopressin V1a receptor; AVPR V1a; Antidiuretic hormone receptor 1a; Vascular/hepatic-type arginine vasopressin receptor; Avpr1a recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 7-52aa; Partial
• Sequence: SQDRSVGNSSPWWPLTTEGSNGSQEAARLGEGDSPLGDVRNEELAK
• Sequence Length: 424

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for Avpr1a recombinant protein

Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger system. Involved in social mory formation.

References

Molecular cloning and expression of a rat V1a arginine vasopressin receptor.Morel A., O'Carroll A.-M., Brownstein M.J., Lolait S.J.Nature 356:523-526(1992) Homology between neurohypophyseal hormone receptors.Wheatley M., Howl J., Morel A., Davis A.R.L.Biochem. J. 296:519-519(1993) Sequence identity between the rat and human vasopressin V1a receptors.Innamorati G., Lolait S.J., Birnbaumer M.Biochem. J. 314:710-711(1996) Molecular cloning and expression of rat V1a and V2 arginine vasopressin receptors.Morel A., Lolait S.J., Brownstein M.J.Regul. Pept. 45:53-59(1993) Tyr115 is the key residue for determining agonist selectivity in the V1a vasopressin receptor.Chini B., Mouillac B., Ala Y., Balestre M.-N., Trumpp-Kallmeyer S., Hoflack J., Elands J., Hibert M., Manning M., Jard S., Barberis C.EMBO J. 14:2176-2182(1995) Localization of V1a vasopressin receptor mRNA expression in cultured neurons, astroglia, and oligodendroglia of rat cerebral cortex.Yamazaki R.S., Chen Q., Schreiber S.S., Brinton R.D.Brain Res. Mol. Brain Res. 45:138-140(1997) Effect of N-glycosylation on ligand binding affinity of rat V1a vasopressin receptor.Lee K.-H., Ahn J., Yu D.-H., Jeong H.-S., Lee S.-H., Kim K.-S., Chung I.-Y., Kim J.-H., Lee Y.-S.Biochem. Biophys. Res. Commun. 286:707-713(2001) Palmitoylation of the vasopressin V1a receptor reveals different conformational requirements for signaling, agonist-induced receptor phosphorylation, and sequestration.Hawtin S.R., Tobin A.B., Patel S., Wheatley M.J. Biol. Chem. 276:38139-38146(2001) Immunocytochemical localization of vasopressin v1a receptors in the rat pituitary gonadotropes.Orcel H., Tobin V.A., Alonso G., Rabie A.Endocrinology 143:4385-4388(2002) Viral vector-mediated gene transfer of the vole V1a vasopressin receptor in the rat septum improved social discrimination and active social behaviour.Landgraf R., Frank E., Aldag J.M., Neumann I.D., Sharer C.A., Ren X., Terwilliger E.F., Niwa M., Wigger A., Young L.J.Eur. J. Neurosci. 18:403-411(2003)

NCBI and Uniprot Product Information

• NCBI GI #: 33149327
• NCBI GeneID: 25107
• NCBI Accession #: NP_444178.2
• NCBI GenBank Nucleotide #: NM_053019.2
• UniProt Accession #: P30560; Q5M8D1; Q62874; Q9QW18
• Molecular Weight: 31.9 kDa
• NCBI Official Full Name: vasopressin V1a receptor
• NCBI Official Synonym Full Names: arginine vasopressin receptor 1A
• NCBI Official Symbol: Avpr1a
• NCBI Official Synonym Symbols: V1a; AVPR; V1aR
• NCBI Protein Information: vasopressin V1a receptor
• UniProt Protein Name: Vasopressin V1a receptor
• Protein Family: Vasopressin V1a receptor
• UniProt Gene Name: Avpr1a
• UniProt Synonym Gene Names: V1aR
• UniProt Entry Name: V1AR_RAT

NCBI Description

This gene encodes a receptor for arginine vasopressin, a neurohypophyseal hormone involved in diuresis inhibition, smooth muscle contraction, liver glycogenolysis stimulation and regulation of adrenocorticotropic hormone release from the pituitary. This receptor represents one of three G protein-coupled arginine vasopressin receptors which functions through a phosphotidylinositol-calcium second messenger system in vascular and hepatic tissues. [provided by RefSeq, Jul 2008]

Uniprot Description

AVPR1A: Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl- inositol-calcium second messenger system. Has been involved in social behaviors, including affiliation and attachment. Belongs to the G-protein coupled receptor 1 family. Vasopressin/oxytocin receptor subfamily.

Protein type: Receptor, GPCR; Membrane protein, integral; Membrane protein, multi-pass; GPCR, family 1

Cellular Component: cytoplasmic vesicle; cytoplasmic vesicle membrane; cytosol; integral to membrane; integral to plasma membrane; plasma membrane

Molecular Function: peptide hormone binding; V1A vasopressin receptor binding; vasopressin receptor activity

Biological Process: calcium-mediated signaling; cellular response to hormone stimulus; cellular response to water deprivation; elevation of cytosolic calcium ion concentration; G-protein coupled receptor protein signaling pathway; grooming behavior; maternal behavior; myotube differentiation; negative regulation of female receptivity; negative regulation of transmission of nerve impulse; penile erection; positive regulation of blood pressure; positive regulation of cell growth; positive regulation of cell proliferation; positive regulation of cellular pH reduction; positive regulation of glutamate secretion; positive regulation of glycogen catabolic process; positive regulation of heart rate; positive regulation of prostaglandin biosynthetic process; positive regulation of systemic arterial blood pressure; positive regulation of vasoconstriction; regulation of adrenocorticotropin hormone secretion; regulation of systemic arterial blood pressure by vasopressin; response to corticosterone stimulus; response to inorganic substance; response to organic substance; social behavior; sperm ejaculation; telencephalon development