Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Aurora kinase B (AURKB) Recombinant Protein | AURKB recombinant protein

Recombinant Bovine Aurora kinase B (AURKB)

Gene Names
AURKB; AIM-1; ARK-2; STK-1; STK12
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Aurora kinase B (AURKB); Recombinant Bovine Aurora kinase B (AURKB); AURKB recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-344, full length protein
Sequence
MAQKENAYPWPYGRQTAQPGLNTLPQRVLRKEPVTPSALVLMSRSNAQPTAAPGQKVVENSSGTPNIPKRSFTIDDFEIGRPLGKGKFGNVYLAREKKSHFIVALKVLFKSQIEKEGVEHQLRREIEIQAHLQHPNILRLYNYFYDRRRIYLILEYAPRGELYKELQKSRTFDEQRTATIMEELADALTYCHAKKVIHRDIKPENLLLGLRGELKIADFGWSVHAPSLRRKTMCGTLDYLPPEMIEGRTHNEKVDLWCIGVLCYELLVGNPPFESASHNETYRRIVKVDLKFPPSVPLGAQDFIYKLLKHNPSERLPLAQVSAHPWVRTHSRRVLPPSAPQSVP
Sequence Length
344
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
39,442 Da
NCBI Official Full Name
Aurora kinase B
NCBI Official Synonym Full Names
aurora kinase B
NCBI Official Symbol
AURKB
NCBI Official Synonym Symbols
AIM-1; ARK-2; STK-1; STK12
NCBI Protein Information
aurora kinase B
UniProt Protein Name
Aurora kinase B
Protein Family
UniProt Gene Name
AURKB
UniProt Synonym Gene Names
AIK2; AIM1; AIRK2; ARK2; STK1; STK12; STK5; AIM-1; ARK-2; Aurora-related kinase 2

Uniprot Description

Serine/threonine-protein kinase component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. Involved in the bipolar attachment of spindle microtubules to kinetochores and is a key regulator for the onset of cytokinesis during mitosis. Required for central/midzone spindle assembly and cleavage furrow formation. Key component of the cytokinesis checkpoint, a process required to delay abscission to prevent both premature resolution of intercellular chromosome bridges and accumulation of DNA damage: phosphorylates CHMP4C, leading to retain abscission-competent VPS4 (VPS4A and/or VPS4B) at the midbody ring until abscission checkpoint signaling is terminated at late cytokinesis. AURKB phosphorylates the CPC complex subunits BIRC5/survivin, CDCA8/borealin and INCENP. Phosphorylation of INCENP leads to increased AURKB activity. Other known AURKB substrates involved in centromeric functions and mitosis are CENPA, DES/desmin, GPAF, KIF2C, NSUN2, RACGAP1, SEPT1, VIM/vimentin, HASPIN and histone H3. A positive feedback loop involving HASPIN and AURKB contributes to localization of CPC to centromeres. Phosphorylation of VIM controls vimentin filament segregation in cytokinetic process, whereas histone H3 is phosphorylated at 'Ser-10' and 'Ser-28' during mitosis (H3S10ph and H3S28ph, respectively). AURKB is also required for kinetochore localization of BUB1 and SGO1. Phosphorylation of p53/TP53 negatively regulates its transcriptional activity. Key regulator of active promoters in resting B- and T-lymphocytes: acts by mediating phosphorylation of H3S28ph at active promoters in resting B-cells, inhibiting RNF2/RING1B-mediated ubiquitination of histone H2A and enhancing binding and activity of the USP16 deubiquitinase at transcribed genes ().

Research Articles on AURKB

Similar Products

Product Notes

The AURKB aurkb (Catalog #AAA1319017) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-344, full length protein. The amino acid sequence is listed below: MAQKENAYPW PYGRQTAQPG LNTLPQRVLR KEPVTPSALV LMSRSNAQPT AAPGQKVVEN SSGTPNIPKR SFTIDDFEIG RPLGKGKFGN VYLAREKKSH FIVALKVLFK SQIEKEGVEH QLRREIEIQA HLQHPNILRL YNYFYDRRRI YLILEYAPRG ELYKELQKSR TFDEQRTATI MEELADALTY CHAKKVIHRD IKPENLLLGL RGELKIADFG WSVHAPSLRR KTMCGTLDYL PPEMIEGRTH NEKVDLWCIG VLCYELLVGN PPFESASHNE TYRRIVKVDL KFPPSVPLGA QDFIYKLLKH NPSERLPLAQ VSAHPWVRTH SRRVLPPSAP QSVP. It is sometimes possible for the material contained within the vial of "Aurora kinase B (AURKB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.