Glycerol-3-phosphate acyltransferase, chloroplastic (ATS1) Recombinant Protein | ATS1 recombinant protein
Recombinant Arabidopsis thaliana Glycerol-3-phosphate acyltransferase, chloroplastic (ATS1)
Gene Names
ATS1; ACT1; ACYLTRANSFERASE 1; F3C3.13; F3C3_13; GLYCEROL-3-PHOSPHATE ACYLTRANSFERASE
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glycerol-3-phosphate acyltransferase; chloroplastic (ATS1); Recombinant Arabidopsis thaliana Glycerol-3-phosphate acyltransferase; ATS1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
91-459, Full length protein
Sequence
ELSHSRTFLDARSEQDLLSGIKKEAEAGRLPANVAAGMEELYWNYKNAVLSSGASRADETVVSNMSVAFDRMLLGVEDPYTFNPYHKAVREPFDYYMFVHTYIRPLIDFKNSYVGNASIFSELEDKIRQGHNIVLISNHQSEADPAVISLLLEAQSPFIGENIKCVAGDRVITDPLCKPFSMGRNLICVYSKKHMNDDPELVDMKRKANTRSLKEMATMLRSGGQLIWIAPSGGRDRPNPSTGEWFPAPFDASSVDNMRRLVEHSGAPGHIYPMSLLCYDIMPPPPQVEKEIGEKRLVGFHGTGLSIAPEINFSDVTADCESPNEAKEAYSQALYKSVNEQYEILNSAIKHRRGVEASTSRVSLSQPWN
Sequence Length
369
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
50,421 Da
NCBI Official Full Name
phospholipid/glycerol acyltransferase family protein
NCBI Official Symbol
ATS1
NCBI Official Synonym Symbols
ACT1; ACYLTRANSFERASE 1; F3C3.13; F3C3_13; GLYCEROL-3-PHOSPHATE ACYLTRANSFERASE
NCBI Protein Information
phospholipid/glycerol acyltransferase family protein
UniProt Protein Name
Glycerol-3-phosphate acyltransferase, chloroplastic
Protein Family
UniProt Gene Name
ATS1
UniProt Synonym Gene Names
GPAT
NCBI Description
Encodes a chloroplast glycerol-3-phosphate acyltransferase.Involved in the biosynthesis of chloroplast phosphatidylglycerol.
Uniprot Description
Esterifies acyl-group from acyl-ACP to the sn-1 position of glycerol-3-phosphate. The enzyme from chilling-resistant plants discriminates against non-fluid palmitic acid and selects oleic acid whereas the enzyme from sensitive plants accepts both fatty acids. This is an oleate-selective acyltransferase.
Research Articles on ATS1
Similar Products
Product Notes
The ATS1 ats1 (Catalog #AAA1395224) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 91-459, Full length protein. The amino acid sequence is listed below: ELSHSRTFLD ARSEQDLLSG IKKEAEAGRL PANVAAGMEE LYWNYKNAVL SSGASRADET VVSNMSVAFD RMLLGVEDPY TFNPYHKAVR EPFDYYMFVH TYIRPLIDFK NSYVGNASIF SELEDKIRQG HNIVLISNHQ SEADPAVISL LLEAQSPFIG ENIKCVAGDR VITDPLCKPF SMGRNLICVY SKKHMNDDPE LVDMKRKANT RSLKEMATML RSGGQLIWIA PSGGRDRPNP STGEWFPAPF DASSVDNMRR LVEHSGAPGH IYPMSLLCYD IMPPPPQVEK EIGEKRLVGF HGTGLSIAPE INFSDVTADC ESPNEAKEAY SQALYKSVNE QYEILNSAIK HRRGVEASTS RVSLSQPWN. It is sometimes possible for the material contained within the vial of "Glycerol-3-phosphate acyltransferase, chloroplastic (ATS1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
