ATP synthase protein I (atpI) Recombinant Protein | atpI recombinant protein

Recombinant Escherichia coli ATP synthase protein I (atpI)

• Gene Names: atpI; ECK3732; JW5611; uncI
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: ATP synthase protein I (atpI); Recombinant Escherichia coli ATP synthase protein I (atpI); Recombinant ATP synthase protein I (atpI); ATP synthase protein I; atpI recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-126
• Sequence: SVSLVSRNVARKLLLVQLLVVIASGLLFSLKDPFWGVSAISGGLAVFLPNVLFMIFAWRHQAHTPAKGRVAWTFAFGEAFKVLAMLVLLVVALAVLKAVFLPLIVTWVLVLVVQILAPAVINNKG
• Sequence Length: 126

• Species: Escherichia coli (strain K12)
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

• NCBI GI #: 90111645
• NCBI GeneID: 948251
• NCBI Accession #: NP_418195.2
• NCBI GenBank Nucleotide #: NC_000913.2
• UniProt Accession #: P0ABC0; P03808; P76747; Q2M857; Q47248
• Molecular Weight: 13,632 Da
• NCBI Official Full Name: ATP synthase, membrane-bound accessory factor
• NCBI Official Symbol: atpI
• NCBI Official Synonym Symbols: ECK3732; JW5611; uncI
• NCBI Protein Information: ATP synthase, membrane-bound accessory factor
• UniProt Protein Name: ATP synthase protein I
• Protein Family: ATP synthase
• UniProt Gene Name: atpI
• UniProt Synonym Gene Names: uncI
• UniProt Entry Name: ATPZ_ECOLI

NCBI Description

A nonpolar mutation in the atpI gene shows that the AtpI protein is not an essential component of the H+-ATPase complex . [More information is available at EcoCyc: EG10106].

Uniprot Description

Function: A possible function for this protein is to guide the assembly of the membrane sector of the ATPase enzyme complex.

Subcellular location: Cell inner membrane; Multi-pass membrane protein.

Sequence similarities: Belongs to the bacterial AtpI family.

Sequence caution: The sequence AAA24730.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.The sequence AAA62091.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.The sequence AAA83868.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.The sequence CAA23513.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.The sequence CAA25640.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.The sequence CAA25775.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.