ATP synthase-coupling factor 6, mitochondrial (Atp5j) Recombinant Protein | Atp5j recombinant protein

Recombinant Mouse ATP synthase-coupling factor 6, mitochondrial (Atp5j)

Cat. Num. AAA949712

• Gene Names: Atp5j; CF6
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: ATP synthase-coupling factor 6; mitochondrial (Atp5j); Recombinant Mouse ATP synthase-coupling factor 6; Atp5j recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 33-108, Full length protein
• Sequence: NKELDPVQKLFVDKIREYKSKRQASGGPVDIGPEYQQDLDRELYKLKQMYGKGEMDTFPTFKFDDPKFEVIDKPQS
• Sequence Length: 76

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Atp5j recombinant protein

Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, F0, which comprises the proton channel. The F1 complex consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a single representative of the other 3. The F0 seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the F6 subunit of the F0 complex, required for F1 and F0 interactions. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.

NCBI and Uniprot Product Information

• NCBI GI #: 695271688
• NCBI GeneID: 11957
• NCBI Accession #: NP_001289142.1
• NCBI GenBank Nucleotide #: NM_001302213.1
• UniProt Accession #: P97450
• Molecular Weight: 12,496 Da
• NCBI Official Full Name: ATP synthase-coupling factor 6, mitochondrial
• NCBI Official Synonym Full Names: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F
• NCBI Official Symbol: Atp5j
• NCBI Official Synonym Symbols: CF6
• NCBI Protein Information: ATP synthase-coupling factor 6, mitochondrial
• UniProt Protein Name: ATP synthase-coupling factor 6, mitochondrial
• Protein Family: ATP synthase-coupling factor
• UniProt Gene Name: Atp5j
• UniProt Synonym Gene Names: ATPase subunit F6

NCBI Description

The protein encoded by this gene is a component of mitochondrial adenosine triphosphate synthase, which catalyzes the conversion of ATP from ADP. Mitochondrial adenosine triphosphate synthase consists of extrinsic and intrinsic membrane domains that are joined by a stalk. The protein encoded by this gene is a subunit of the stalk domain. A bi-directional promoter that drives expression of this gene has been has been identified. Pseudogenes of this gene are found on chromosomes 14 and 17. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]

Uniprot Description

Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extramembraneous catalytic core and F0 - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F0 domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha3beta3 subcomplex and subunit a/ATP6 static relative to the rotary elements. Also involved in the restoration of oligomycin-sensitive ATPase activity to depleted F1-F0 complexes.