Sodium/potassium-transporting ATPase subunit beta-1 Recombinant Protein | ATP1B1 recombinant protein
Sodium/potassium-transporting ATPase subunit beta-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sodium/potassium-transporting ATPase subunit beta-1; ATP1B1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-303aa; full length protein
Sequence
MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEEYVRNIVRFLEKYKDSAQKDEMIFEDCGNMPSEIKERGEFNNERGERKVCRFKLEWLGNCSGINDETYGYRDGKPCVLIKLNRVLGFKPKPPKNESLEAYPVMKYSPYVLPVQCTGKRDEDKDRIGNVEYFGLGGYPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS
Sequence Length
Full Length Protein
Species
Canis familiaris (Dog) (Canis lupus familiaris)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for ATP1B1 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for ATP1B1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
35,240 Da
NCBI Official Full Name
Sodium/potassium-transporting ATPase subunit beta-1
NCBI Official Symbol
ATP1B1
NCBI Protein Information
sodium/potassium-transporting ATPase subunit beta-1
UniProt Protein Name
Sodium/potassium-transporting ATPase subunit beta-1
Protein Family
UniProt Gene Name
ATP1B1
UniProt Entry Name
AT1B1_CANLF
Uniprot Description
This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na+ and K+ ions across the plasma membrane. The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane.
Research Articles on ATP1B1
Similar Products
Product Notes
The ATP1B1 atp1b1 (Catalog #AAA7042144) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-303aa; full length protein. The amino acid sequence is listed below: MARGKAKEEG SWKKFIWNSE KKEFLGRTGG SWFKILLFYV IFYGCLAGIF IGTIQVMLLT ISEFKPTYQD RVAPPGLTQI PQIQKTEISF RPNDPKSYEE YVRNIVRFLE KYKDSAQKDE MIFEDCGNMP SEIKERGEFN NERGERKVCR FKLEWLGNCS GINDETYGYR DGKPCVLIKL NRVLGFKPKP PKNESLEAYP VMKYSPYVLP VQCTGKRDED KDRIGNVEYF GLGGYPGFPL QYYPYYGKLL QPKYLQPLLA VQFTNLTMDT EIRIECKAYG ENIGYSEKDR FQGRFDVKIE VKS. It is sometimes possible for the material contained within the vial of "Sodium/potassium-transporting ATPase subunit beta-1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
