Iron-sulfur clusters transporter atm1 (atm1) Recombinant Protein | atm1 recombinant protein
Recombinant Emericella nidulans Iron-sulfur clusters transporter atm1, mitochondrial (atm1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Iron-sulfur clusters transporter atm1 (atm1); Recombinant Emericella nidulans Iron-sulfur clusters transporter atm1; mitochondrial (atm1); atm1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
18-721aa; full length protein
Sequence
VSHRPAFPRSNPVSAALGGTQFRKLSVKTQTDKNTLSDKKTAEADTSSSSSSAKSAAPSQ QKTQNATTAQKNLLSESTVANKEQRKADWAIMREMAKYLWPKGDWGTKLRVGTALSLLVG AKVLNVEVPFYFKSIVDSMNVDFAAVGGTAYTVAGSMIIAYGATRIGATFFQELRNAVFA SVAQKAIRKVARNVFEHLLRLDLNFHLSRQTGGLTRAIDRGTKGISFLLTSMVFHVVPTA LEISLVCGILTHQYGIKFAAITATTMLAYSAFTIATTAWRTKFRKQANAADNRGATVAVD SLINYEAVKYFNNEKFEVARYDKALKAYEDASIKVTTSLAFLNSGQNMIFSSALAAMMYL AADGVATGSLTVGDLVMVNQLVFQLSVPLNFLGSVYRELRQSLLDMETLFNLQKVNVNIK EKPDAKPLELKQGGQIRFENVTFGYHPERPILKNASFTIPAGQKFAIVGPSGCGKSTILR LLFRYYDVQEGRILVDGQDIRHVTIESLRKAIGVVPQDTPLFNDTIEHNIRYGRLDASDE EVRKAARRAHIHELVERLPEGYRTAVGERGMMISGGEKQRLAISRLLLKDPQLLFFDEAT SALDTYTEQALMQNINSILKEKGRTSVFVAHRLRTIYDCDQILVLKDGQVAELGSHRELL DLDGIYAELWSAQETSLAQDPEYERNAGLEGETAGEVEDKAPRQ
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for atm1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
79,800 Da
NCBI Official Full Name
hypothetical protein AN5528.2
NCBI Official Symbol
AN5528.2
NCBI Protein Information
hypothetical protein
UniProt Protein Name
Iron-sulfur clusters transporter atm1, mitochondrial
Protein Family
UniProt Gene Name
atm1
UniProt Entry Name
ATM1_EMENI
Uniprot Description
Performs an essential function in the generation of cytoplasmic iron-sulfur proteins by mediating the ATP-dependent export of Fe/S cluster precursors synthesized by NFS1 and other mitochondrial proteins. Hydrolyzes ATP. Binds glutathione and may function by transporting a glutathione-conjugated iron-sulfur compound ().
Similar Products
Product Notes
The atm1 atm1 (Catalog #AAA7008402) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 18-721aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the atm1 atm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VSHRPAFPRS NPVSAALGGT QFRKLSVKTQ TDKNTLSDKK TAEADTSSSS SSAKSAAPSQ QKTQNATTAQ KNLLSESTVA NKEQRKADWA IMREMAKYLW PKGDWGTKLR VGTALSLLVG AKVLNVEVPF YFKSIVDSMN VDFAAVGGTA YTVAGSMIIA YGATRIGATF FQELRNAVFA SVAQKAIRKV ARNVFEHLLR LDLNFHLSRQ TGGLTRAIDR GTKGISFLLT SMVFHVVPTA LEISLVCGIL THQYGIKFAA ITATTMLAYS AFTIATTAWR TKFRKQANAA DNRGATVAVD SLINYEAVKY FNNEKFEVAR YDKALKAYED ASIKVTTSLA FLNSGQNMIF SSALAAMMYL AADGVATGSL TVGDLVMVNQ LVFQLSVPLN FLGSVYRELR QSLLDMETLF NLQKVNVNIK EKPDAKPLEL KQGGQIRFEN VTFGYHPERP ILKNASFTIP AGQKFAIVGP SGCGKSTILR LLFRYYDVQE GRILVDGQDI RHVTIESLRK AIGVVPQDTP LFNDTIEHNI RYGRLDASDE EVRKAARRAH IHELVERLPE GYRTAVGERG MMISGGEKQR LAISRLLLKD PQLLFFDEAT SALDTYTEQA LMQNINSILK EKGRTSVFVA HRLRTIYDCD QILVLKDGQV AELGSHRELL DLDGIYAELW SAQETSLAQD PEYERNAGLE GETAGEVEDK APRQ. It is sometimes possible for the material contained within the vial of "Iron-sulfur clusters transporter atm1 (atm1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
