E3 ubiquitin-protein ligase ATL9 (ATL9) Recombinant Protein | ATL9 recombinant protein
Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase ATL9 (ATL9)
Gene Names
AT2G35000; F19I3.23; F19I3_23
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 ubiquitin-protein ligase ATL9 (ATL9); Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase ATL9 (ATL9); ATL9 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
34-378aa; full length protein
Sequence
QTQTTPPGTTKTKPNDPVVVVITVLFLVIFFMVFGSIFCRRSNAQFSRSSIFRSTDADAE SQVVRIRRLTARGLDAEAIETFPTFLYSEVKAVRIGKGGVECAVCLCEFEDDETLRLMPP CCHVFHADCVDVWLSEHSTCPLCRADLVLNQQGDDDDSTESYSGTDPGTISSSTDPERGM VLESSDAHLLDAVTWSNSNITPRSKSTGLSSWQITGILFPRSHSTGHSLIQPAGNLDRFT LRLPDDVRRQLMKTSRTMGHVALLPQARSSRSGYRSGSVGSERSAFPYGRKSNNNNRRLH SLSFSFSFRSGSVRSTFSGDAPKNLPTSIEAGERSFERLRPDERV
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for ATL9 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
41,880 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase ATL9
NCBI Official Symbol
AT2G35000
NCBI Official Synonym Symbols
F19I3.23; F19I3_23
NCBI Protein Information
E3 ubiquitin-protein ligase ATL9
UniProt Protein Name
E3 ubiquitin-protein ligase ATL9
Protein Family
UniProt Gene Name
ATL9
UniProt Entry Name
ATL9_ARATH
NCBI Description
E3 ligase-like protein induced by chitin oligomers.
Uniprot Description
E3 ubiquitin-protein ligase able to catalyze polyubiquitination with ubiquitin-conjugating enzyme E2 UBC8 in vitro. May be involved in the early steps of the plant defense signaling pathway.
Research Articles on ATL9
Similar Products
Product Notes
The ATL9 atl9 (Catalog #AAA7008394) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 34-378aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the ATL9 atl9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QTQTTPPGTT KTKPNDPVVV VITVLFLVIF FMVFGSIFCR RSNAQFSRSS IFRSTDADAE SQVVRIRRLT ARGLDAEAIE TFPTFLYSEV KAVRIGKGGV ECAVCLCEFE DDETLRLMPP CCHVFHADCV DVWLSEHSTC PLCRADLVLN QQGDDDDSTE SYSGTDPGTI SSSTDPERGM VLESSDAHLL DAVTWSNSNI TPRSKSTGLS SWQITGILFP RSHSTGHSLI QPAGNLDRFT LRLPDDVRRQ LMKTSRTMGH VALLPQARSS RSGYRSGSVG SERSAFPYGR KSNNNNRRLH SLSFSFSFRS GSVRSTFSGD APKNLPTSIE AGERSFERLR PDERV. It is sometimes possible for the material contained within the vial of "E3 ubiquitin-protein ligase ATL9 (ATL9), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
