Atlastin-2 (Atl2) Recombinant Protein | Atl2 recombinant protein
Recombinant Mouse Atlastin-2 (Atl2)
Gene Names
Atl2; Aip-2; Arl6ip2; AA407293; AV334690; 2010110I21Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Atlastin-2 (Atl2); Recombinant Mouse Atlastin-2 (Atl2); Atl2 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-583aa; full length protein
Sequence
MAEGDEAARRQQPQQGLRRRRQTSDSSVGVNHVSSTTSLGEDYEDDDLVNSDEVMKKPCP VQIVLAHEDDHNFELDEEALEQILLQEHIRDLNIVVVSVAGAFRKGKSFLLDFMLRYMYN KDSQSWIGGNNEPLTGFTWRGGCERETTGIQVWNEVFVIDRPNGTKVAVLLMDTQGAFDS QSTIKDCATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAMEEIYQKPFQTLM FLIRDWSYPYEHSYGLEGGKQFLEKRLQVKQNQHEELQNVRKHIHNCFSNLGCFLLPHPG LKVATNPSFDGRLKDIDEDFKRELRNLVPLLLAPENLVEKEISGSKVTCRDLVEYFKAYI KIYQGEELPHPKSMLQATAEANNLAAVAGARDVYCKSMEQVCGGDKPYIAPSDLERKHLD LKEVALKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYAARTPATLFA VMFAMYIISGLTGFIGLNSIAVLCNLVMGLALTSLCTWAYVKYSGEFREIGTMIDQIAET LWEQVLKPLGDNLMEENIRQSVTNSIKAGLTDQVSHHARLKTD
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Atl2 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
44,356 Da
NCBI Official Full Name
atlastin-2 isoform 1
NCBI Official Synonym Full Names
atlastin GTPase 2
NCBI Official Symbol
Atl2
NCBI Official Synonym Symbols
Aip-2; Arl6ip2; AA407293; AV334690; 2010110I21Rik
NCBI Protein Information
atlastin-2
UniProt Protein Name
Atlastin-2
Protein Family
UniProt Gene Name
Atl2
UniProt Synonym Gene Names
Arl6ip2; ARL-6-interacting protein 2; Aip-2
UniProt Entry Name
ATLA2_MOUSE
Uniprot Description
ARL6IP2: GTPase tethering membranes through formation of trans- homooligomer and mediating homotypic fusion of endoplasmic reticulum membranes. Functions in endoplasmic reticulum tubular network biogenesis. Belongs to the GBP family. Atlastin subfamily. 4 isoforms of the human protein are produced by alternative splicing.
Protein type: EC 3.6.5.-; Membrane protein, multi-pass; Membrane protein, integral
Cellular Component: endoplasmic reticulum; integral to membrane; membrane
Molecular Function: GTP binding; GTPase activity; hydrolase activity; identical protein binding; nucleotide binding; protein binding
Biological Process: endoplasmic reticulum organization and biogenesis; Golgi organization and biogenesis; protein homooligomerization
Similar Products
Product Notes
The Atl2 atl2 (Catalog #AAA7008324) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-583aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Atl2 atl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAEGDEAARR QQPQQGLRRR RQTSDSSVGV NHVSSTTSLG EDYEDDDLVN SDEVMKKPCP VQIVLAHEDD HNFELDEEAL EQILLQEHIR DLNIVVVSVA GAFRKGKSFL LDFMLRYMYN KDSQSWIGGN NEPLTGFTWR GGCERETTGI QVWNEVFVID RPNGTKVAVL LMDTQGAFDS QSTIKDCATV FALSTMTSSV QVYNLSQNIQ EDDLQHLQLF TEYGRLAMEE IYQKPFQTLM FLIRDWSYPY EHSYGLEGGK QFLEKRLQVK QNQHEELQNV RKHIHNCFSN LGCFLLPHPG LKVATNPSFD GRLKDIDEDF KRELRNLVPL LLAPENLVEK EISGSKVTCR DLVEYFKAYI KIYQGEELPH PKSMLQATAE ANNLAAVAGA RDVYCKSMEQ VCGGDKPYIA PSDLERKHLD LKEVALKQFR SVKKMGGDEF CRRYQDQLEA EIEETYANFI KHNDGKNIFY AARTPATLFA VMFAMYIISG LTGFIGLNSI AVLCNLVMGL ALTSLCTWAY VKYSGEFREI GTMIDQIAET LWEQVLKPLG DNLMEENIRQ SVTNSIKAGL TDQVSHHARL KTD. It is sometimes possible for the material contained within the vial of "Atlastin-2 (Atl2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
