Autophagy-related protein 8 (ATG8) Recombinant Protein | CAGL0A04675g recombinant protein

Recombinant Candida glabrata Autophagy-related protein 8 (ATG8)

Cat. Num. AAA7087277

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Autophagy-related protein 8 (ATG8); Recombinant Candida glabrata Autophagy-related protein 8 (ATG8); Autophagy-related ubiquitin-like modifier ATG8; CAGL0A04675g recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-116aa; Full Length
• Sequence: MKSSFKSEYPFEKRKAESERISEKFQNRIPVICEKAEKSDIPEVDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTASLMSQVYQEHKDKDGFLYVTYSGENTFG
• Sequence Length: 118

• Species: Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

Related Product Information for CAGL0A04675g recombinant protein

Ubiquitin-like modifier involved in cytoplasm to vacuole transport (Cvt) vesicles and autophagosomes formation. With ATG4, mediates the delivery of the vesicles and autophagosomes to the vacuole via the microtubule cytoskeleton. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirents and preventing excess ROS production. Participates also in mbrane fusion events that take place in the early secretory pathway. Also involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. The ATG8-PE conjugate mediates tethering between adjacent mbranes and stimulates mbrane hifusion, leading to expansion of the autophagosomal mbrane during autophagy .

References

Genome evolution in yeasts.Dujon B., Sherman D., Fischer G., Durrens P., Casaregola S., Lafontaine I., de Montigny J., Marck C., Neuveglise C., Talla E., Goffard N., Frangeul L., Aigle M., Anthouard V., Babour A., Barbe V., Barnay S., Blanchin S., Beckerich J.-M., Beyne E., Bleykasten C., Boisrame A., Boyer J., Cattolico L., Confanioleri F., de Daruvar A., Despons L., Fabre E., Fairhead C., Ferry-Dumazet H., Groppi A., Hantraye F., Hennequin C., Jauniaux N., Joyet P., Kachouri R., Kerrest A., Koszul R., Lemaire M., Lesur I., Ma L., Muller H., Nicaud J.-M., Nikolski M., Oztas S., Ozier-Kalogeropoulos O., Pellenz S., Potier S., Richard G.-F., Straub M.-L., Suleau A., Swennen D., Tekaia F., Wesolowski-Louvel M., Westhof E., Wirth B., Zeniou-Meyer M., Zivanovic Y., Bolotin-Fukuhara M., Thierry A., Bouchier C., Caudron B., Scarpelli C., Gaillardin C., Weissenbach J., Wincker P., Souciet J.-L.Nature 430:35-44(2004)

NCBI and Uniprot Product Information

• NCBI GI #: 50285085
• NCBI GeneID: 2886410
• NCBI Accession #: XP_444971.1
• NCBI GenBank Nucleotide #: XM_444971.1
• UniProt Accession #: Q6FXR8
• Molecular Weight: 29.5 kDa
• NCBI Official Full Name: uncharacterized protein CAGL0A04675g
• NCBI Official Symbol: CAGL0A04675g
• NCBI Protein Information: hypothetical protein
• UniProt Protein Name: Autophagy-related protein 8
• UniProt Gene Name: ATG8
• UniProt Synonym Gene Names: AUT7

Uniprot Description

Ubiquitin-like modifier involved in autophagosomes formation. With ATG4, mediates the delivery of the autophagosomes to the vacuole via the microtubule cytoskeleton. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Participates also in membrane fusion events that take place in the early secretory pathway. Also involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy.