Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Activating transcription factor 7-interacting protein 2 (Atf7ip2) Recombinant Protein | Atf7ip2 recombinant protein

Recombinant Mouse Activating transcription factor 7-interacting protein 2 (Atf7ip2)

Gene Names
Atf7ip2; PSM2; Get-1; BC018510; 4930558K11Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Activating transcription factor 7-interacting protein 2 (Atf7ip2); Recombinant Mouse Activating transcription factor 7-interacting protein 2 (Atf7ip2); Atf7ip2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-452, full length protein
Sequence
MESPDRKRQKVLKAKKTMPTSYQKQLEILNKSTNVEAPKTTVGTNIPNGHNQKMFSKNKENVKVMKVSEQINENACGALERHTALLEQVKHWIRQEICMINCNLFDKKLNELNERIGKTQCKSRHEAIAGELFVKIRRLQKRIKTVLSSQRNCLEPNTLPSNTVCKVTDSEAMNLNVTQKSVKSRSKRISSVNHTPLNSSEKAGRKTNLPSTCVEFASESNTDDVMLISVKNSNLTTSITSEQTEIRKNTSRNLSNSPNSMIKVGPVEKKFDFVIDLTREGPSNYSIESPSFTLKSTSKAVLRSKEIIPVAENGNEGFGSFEHLPPLPEPPAPLPEMADKIKDTLPPQKPELKVKWVLRPTSIALTWNIPKVNPNCAPVESYHLFLYYENSDHLTWKKIAEIKALPLPMACTLSQNLASTKYYFAVQSKDIFGRYGPFCNIKSIPRFSENLT
Sequence Length
452
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,487 Da
NCBI Official Full Name
activating transcription factor 7-interacting protein 2 isoform 2
NCBI Official Synonym Full Names
activating transcription factor 7 interacting protein 2
NCBI Official Symbol
Atf7ip2
NCBI Official Synonym Symbols
PSM2; Get-1; BC018510; 4930558K11Rik
NCBI Protein Information
activating transcription factor 7-interacting protein 2
UniProt Protein Name
Activating transcription factor 7-interacting protein 2
UniProt Gene Name
Atf7ip2
UniProt Synonym Gene Names
Mcaf2; Psm2

Uniprot Description

Recruiter that couples transcriptional factors to general transcription apparatus and thereby modulates transcription regulation and chromatin formation. Can both act as an activator or a repressor depending on the context. Mediates MBD1-dependent transcriptional repression, probably by recruiting complexes containing SETDB1. The complex formed with MBD1 and SETDB1 represses transcription and probably couples DNA methylation and histone H3 'Lys-9' trimethylation (H3K9me3) activity ().

Research Articles on Atf7ip2

Similar Products

Product Notes

The Atf7ip2 atf7ip2 (Catalog #AAA1377027) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-452, full length protein. The amino acid sequence is listed below: MESPDRKRQK VLKAKKTMPT SYQKQLEILN KSTNVEAPKT TVGTNIPNGH NQKMFSKNKE NVKVMKVSEQ INENACGALE RHTALLEQVK HWIRQEICMI NCNLFDKKLN ELNERIGKTQ CKSRHEAIAG ELFVKIRRLQ KRIKTVLSSQ RNCLEPNTLP SNTVCKVTDS EAMNLNVTQK SVKSRSKRIS SVNHTPLNSS EKAGRKTNLP STCVEFASES NTDDVMLISV KNSNLTTSIT SEQTEIRKNT SRNLSNSPNS MIKVGPVEKK FDFVIDLTRE GPSNYSIESP SFTLKSTSKA VLRSKEIIPV AENGNEGFGS FEHLPPLPEP PAPLPEMADK IKDTLPPQKP ELKVKWVLRP TSIALTWNIP KVNPNCAPVE SYHLFLYYEN SDHLTWKKIA EIKALPLPMA CTLSQNLAST KYYFAVQSKD IFGRYGPFCN IKSIPRFSEN LT. It is sometimes possible for the material contained within the vial of "Activating transcription factor 7-interacting protein 2 (Atf7ip2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.