Agouti-signaling (ASIP) Recombinant Protein | ASIP recombinant protein

Recombinant Human Agouti-signaling protein (ASIP), partial

Cat. Num. AAA7136920

• Gene Names: ASIP; ASP; AGSW; AGTI; AGTIL; SHEP9
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Agouti-signaling (ASIP); Recombinant Human Agouti-signaling protein (ASIP); partial; ASP; Agouti switch protein; ASIP recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process); If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.; If the delivery form is lyophilized powder, the buffer before lyop
• Sequence Positions: 23-112aa; Partial
• Sequence: HLPPEEKLRDDRSLRSNSSVNLLDVPSVSIVALNKKSKQIGRKAAEKKRSSKKEASMKKVVRPRTPLSAPCVATRNSCKPPAPACCDPCA

• Species: Human
• Tag: N-terminal 6xHis-GST-tagged
• Function: Involved in the regulation of melanogenesis. The binding of ASP to MC1R precludes alpha-MSH initiated signaling and thus blocks production of cAMP, leading to a down-regulation of eumelanogenesis (brown/black pigment) and thus increasing synthesis of pheomelanin (yellow/red pigment). In higher primates, agouti may affect the quality of hair pigmentation rather than its pattern of deposition. Could well play a role in neuroendocrine aspects of melanocortin action. May have some functional role in regulating the lipid metabolism with adipocytes.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Product Categories/Family for ASIP recombinant protein

Neuroscience

References

"ASIP and TYR pigmentation variants associate with cutaneous melanoma and basal cell carcinoma."Gudbjartsson D.F., Sulem P., Stacey S.N., Goldstein A.M., Rafnar T., Sigurgeirsson B., Benediktsdottir K.R., Thorisdottir K., Ragnarsson R., Sveinsdottir S.G., Magnusson V., Lindblom A., Kostulas K., Botella-Estrada R., Soriano V., Juberias P., Grasa M., Saez B. Stefansson K.Nat Genet 40:886-891 (2008)

NCBI and Uniprot Product Information

• NCBI GI #: 540073
• NCBI GeneID: 434
• UniProt Accession #: P42127; Q3SXL2
• Molecular Weight: 14,515 Da
• NCBI Official Full Name: agouti
• NCBI Official Synonym Full Names: agouti signaling protein
• NCBI Official Symbol: ASIP
• NCBI Official Synonym Symbols: ASP; AGSW; AGTI; AGTIL; SHEP9
• NCBI Protein Information: agouti-signaling protein; nonagouti homolog; agouti switch protein; agouti signaling protein, nonagouti homolog
• UniProt Protein Name: Agouti-signaling protein
• Protein Family: Agouti-signaling protein
• UniProt Gene Name: ASIP
• UniProt Synonym Gene Names: AGTI; AGTIL; ASP; ASP
• UniProt Entry Name: ASIP_HUMAN

NCBI Description

In mice, the agouti gene encodes a paracrine signaling molecule that causes hair follicle melanocytes to synthesize pheomelanin, a yellow pigment, instead of the black or brown pigment, eumelanin. Pleiotropic effects of constitutive expression of the mouse gene include adult-onset obesity, increased tumor susceptibility, and premature infertility. This gene is highly similar to the mouse gene and encodes a secreted protein that may (1) affect the quality of hair pigmentation, (2) act as a pharmacological antagonist of alpha-melanocyte-stimulating hormone, (3) play a role in neuroendocrine aspects of melanocortin action, and (4) have a functional role in regulating lipid metabolism in adipocytes. [provided by RefSeq, Jul 2008]

Uniprot Description

ASIP: Involved in the regulation of melanogenesis. The binding of ASP to MC1R precludes alpha-MSH initiated signaling and thus blocks production of cAMP, leading to a down-regulation of eumelanogenesis (brown/black pigment) and thus increasing synthesis of pheomelanin (yellow/red pigment). In higher primates, agouti may affect the quality of hair pigmentation rather than its pattern of deposition. Could well play a role in neuroendocrine aspects of melanocortin action. May have some functional role in regulating the lipid metabolism with adipocytes.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 20q11.2-q12

Cellular Component: extracellular space

Molecular Function: type 3 melanocortin receptor binding; type 4 melanocortin receptor binding; receptor binding

Biological Process: melanin biosynthetic process; generation of precursor metabolites and energy; regulation of molecular function, epigenetic; hormone-mediated signaling; cell-cell signaling; melanosome organization and biogenesis; adult feeding behavior; signal transduction; melanosome transport

Disease: Skin/hair/eye Pigmentation, Variation In, 9