Acid-sensing ion channel 1 (ASIC1) Recombinant Protein | ASIC1 recombinant protein

Recombinant Human Acid-sensing ion channel 1 (ASIC1), partial

Cat. Num. AAA968511

• Gene Names: ASIC1; ASIC; ACCN2; BNaC2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Acid-sensing ion channel 1 (ASIC1); Recombinant Human Acid-sensing ion channel 1 (ASIC1); partial; ASIC1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 70-427
• Sequence: HYHHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNNRYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEVCSAEDFKVVFTRYGKCYTFNSGRDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRLIYLPPPWGTCKAVTMDSDLDFFDSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNYETIEQKKAYE
• Sequence Length: 528

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 21536349
• NCBI GeneID: 41
• NCBI Accession #: NP_001086.2
• NCBI GenBank Nucleotide #: NM_001095.3
• UniProt Accession #: P78348; P78349; Q96CV2; A3KN86; E5KBL7
• Molecular Weight: 62,700 Da
• NCBI Official Full Name: acid-sensing ion channel 1 isoform b
• NCBI Official Synonym Full Names: acid sensing ion channel subunit 1
• NCBI Official Symbol: ASIC1
• NCBI Official Synonym Symbols: ASIC; ACCN2; BNaC2
• NCBI Protein Information: acid-sensing ion channel 1
• UniProt Protein Name: Acid-sensing ion channel 1
• Protein Family: Acid-sensing ion channel
• UniProt Gene Name: ASIC1
• UniProt Synonym Gene Names: ACCN2; BNAC2; BNaC2

NCBI Description

This gene encodes a member of the acid-sensing ion channel (ASIC) family of proteins, which are part of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. Members of the ASIC family are sensitive to amiloride and function in neurotransmission. The encoded proteins function in learning, pain transduction, touch sensation, and development of memory and fear. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2012]

Uniprot Description

Isoform 2 and isoform 3 function as proton-gated sodium channels; they are activated by a drop of the extracellular pH and then become rapidly desensitized. The channel generates a biphasic current with a fast inactivating and a slow sustained phase. Has high selectivity for sodium ions and can also transport lithium ions with high efficiency. Isoform 2 can also transport potassium, but with lower efficiency. It is nearly impermeable to the larger rubidium and cesium ions. Isoform 3 can also transport calcium ions. Mediates glutamate-independent Ca2+ entry into neurons upon acidosis. This Ca2+ overloading is toxic for cortical neurons and may be in part responsible for ischemic brain injury. Heteromeric channel assembly seems to modulate channel properties. Functions as a postsynaptic proton receptor that influences intracellular Ca2+ concentration and calmodulin-dependent protein kinase II phosphorylation and thereby the density of dendritic spines. Modulates activity in the circuits underlying innate fear.