SDS-PAGE
Actin-related protein 2/3 complex subunit 5-like protein (ARPC5L) Recombinant Protein | ARPC5L recombinant protein
Recombinant Human Actin-related protein 2/3 complex subunit 5-like protein (ARPC5L)
Gene Names
ARPC5L; ARC16-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Actin-related protein 2/3 complex subunit 5-like protein (ARPC5L); Recombinant Human Actin-related protein 2/3 complex subunit 5-like protein (ARPC5L); Actin-related protein 2/3 complex subunit 5-like protein; Arp2/3 complex 16 kDa subunit 2; ARC16-2; ARPC5L recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-154aa; Full Length of Isoform 2
Sequence
MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRHSITGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAMLLQWHEKALAAGGVGSIVRVLTARKTV
Sequence Length
153
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for ARPC5L recombinant protein
Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.
Product Categories/Family for ARPC5L recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
43.6 kDa
NCBI Official Full Name
actin-related protein 2/3 complex subunit 5-like protein
NCBI Official Synonym Full Names
actin related protein 2/3 complex, subunit 5-like
NCBI Official Symbol
ARPC5L
NCBI Official Synonym Symbols
ARC16-2
NCBI Protein Information
actin-related protein 2/3 complex subunit 5-like protein; arp2/3 complex 16 kDa subunit 2
UniProt Protein Name
Actin-related protein 2/3 complex subunit 5-like protein
Protein Family
UniProt Gene Name
ARPC5L
UniProt Synonym Gene Names
ARC16-2
UniProt Entry Name
ARP5L_HUMAN
Uniprot Description
ARPC5L: May function as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Belongs to the ARPC5 family.
Chromosomal Location of Human Ortholog: 9q33.3
Cellular Component: Arp2/3 protein complex; focal adhesion; cytoplasm
Molecular Function: actin binding
Similar Products
Product Notes
The ARPC5L arpc5l (Catalog #AAA1329454) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-154aa; Full Length of Isoform 2. The amino acid sequence is listed below: MSKNTVSSAR FRKVDVDEYD ENKFVDEEDG GDGQAGPDEG EVDSCLRHSI TGNMTAALQA ALKNPPINTK SQAVKDRAGS IVLKVLISFK ANDIEKAVQS LDKNGVDLLM KYIYKGFESP SDNSSAMLLQ WHEKALAAGG VGSIVRVLTA RKTV. It is sometimes possible for the material contained within the vial of "Actin-related protein 2/3 complex subunit 5-like protein (ARPC5L), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
