Actin-related protein 6 (ARP6) Recombinant Protein | ARP6 recombinant protein

Recombinant Arabidopsis thaliana Actin-related protein 6 (ARP6)

Cat. Num. AAA1319246

• Gene Names: ARP6; actin-related protein 6; ATARP6; EARLY IN SHORT DAYS 1; ESD1; SUF3; SUPPRESSOR OF FRI 3
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Actin-related protein 6 (ARP6); Recombinant Arabidopsis thaliana Actin-related protein 6 (ARP6); ARP6 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-421, Full length protein
• Sequence: MSNIVVLDNGGGLIKAGQGGERDPTTVIPNCLYKPLSSKKFIHPSPLTTLSDEIDLTSAAVRRPIDRGYLINSDLQREIWSHLFTSLLHIAPSSSSLLLTEAPLSIPSVQRTTDELVFEDFGFSSLYIAHPQSLVHLYEASRQPDSILSKTQCSLVVDCGFSFTHAVPVLHNFTLNHAIKRIDLGGKAFTNYLKELVSYRSINVMDETFLVDDAKEKLCFVSLDLLRDLRLARNGNTLIKSTYVLPDGVTHTKGYVKDPQAAKRFLSLSEKESVVVMDKVGERKKADMNKNEIDLTNERFLVPETLFQPADLGMNQAGLAECIVRAINSCHSYLQPVLYQSIILTGGSTLFPQLKERLEGELRPLVPDHFDVKITTQEDPILGVWRGGSLLASSPDFESMCVTKAEYEELGSARCRRRFFH
• Sequence Length: 421

• Species: Arabidopsis thaliana (Mouse-ear cress)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 18406999
• NCBI GeneID: 823150
• NCBI Accession #: NP_566861.1
• NCBI GenBank Nucleotide #: NM_114070.4
• UniProt Accession #: Q8LGE3; Q8GZL0; Q8GZL1; Q8GZL2; Q8GZL3; Q8GZL4; Q8GZL5; Q8GZL6; Q8GZL7; Q8GZL8; Q8GZL9; Q8GZM0
• Molecular Weight: 46,944 Da
• NCBI Official Full Name: actin-related protein 6
• NCBI Official Symbol: ARP6
• NCBI Official Synonym Symbols: actin-related protein 6; ATARP6; EARLY IN SHORT DAYS 1; ESD1; SUF3; SUPPRESSOR OF FRI 3
• NCBI Protein Information: actin-related protein 6
• UniProt Protein Name: Actin-related protein 6
• Protein Family: Actin-like protein
• UniProt Gene Name: ARP6
• UniProt Synonym Gene Names: ESD1; SUF3

NCBI Description

Encodes ACTIN-RELATED PROTEIN6 (ARP6), a putative component of a chromatin-remodeling complex. Required for both histone acetylation and methylation of the FLC chromatin in Arabidopsis. Along with PIE1 forms a complex to deposit modified histone H2A.Z at several loci within the genome. This modification alters the expression of the target genes (i.e. FLC, MAF4, MAF6). Incorporation of this variant histone into chromatin mediates the ambient temperature response. Located at specific regions of the nuclear periphery. Expression throughout plants shown by in-situ and immunolocalization methods. Mutants show defects in fertility, leaf, flower and inflorescence development and shorter flowering times. ARP6 also is involved in globally controlling developmental responses to ambient temperature through incorporation of variant histone H2A.Z into chromatin.

Uniprot Description

Component of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant H2A.F/Z leading to transcriptional regulation of selected genes (e.g. FLC) by chromatin remodeling. Binds to the promoter region of FLC chromatin. Required for the activation of FLC and FLC/MAF genes expression to levels that inhibit flowering, through both histone H3 and H4 acetylation and methylation mechanisms. Involved in several developmental processes including organization of plant organs, leaves formation, flowering time repression, and fertility. Modulates photoperiod-dependent epidermal leaves cell development; promotes cell division in long days, and cell expansion/division in short days. May be involved in the regulation of pathogenesis-related proteins (PRs).