ADP-ribosylation factor-like protein 6-interacting protein 1 (ARL6IP1) Recombinant Protein | ARL6IP1 recombinant protein

Recombinant Human ADP-ribosylation factor-like protein 6-interacting protein 1 (ARL6IP1)

Cat. Num. AAA7007994

• Gene Names: ARL6IP1; AIP1; ARMER; SPG61; ARL6IP
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: ADP-ribosylation factor-like protein 6-interacting protein 1 (ARL6IP1); Recombinant Human ADP-ribosylation factor-like protein 6-interacting protein 1 (ARL6IP1); ARL6IP1 recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 1-203aa; full length protein
• Sequence: MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIY YLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAV GWWKRLFTLKEEKPKMYFMTMIVSLAAVAWVGQQVHNLLLTYLIVTSLLLLPGLNQHGII LKYIGMAKREINKLLKQKEKKNE
• Sequence Length: Full length protein

• Application Notes: This is a recombinant transmembrane protein expressed in a cell-free expression system.
• Species: Human
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Product Categories/Family for ARL6IP1 recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

• NCBI GI #: 924966810
• NCBI GeneID: 23204
• NCBI Accession #: NP_001300787.1
• NCBI GenBank Nucleotide #: NM_001313858.1
• UniProt Accession #: Q15041; B7Z6S5; B7Z791; F5GXP4
• Molecular Weight: 17,158 Da
• NCBI Official Full Name: ADP-ribosylation factor-like protein 6-interacting protein 1 isoform 2
• NCBI Official Synonym Full Names: ADP ribosylation factor like GTPase 6 interacting protein 1
• NCBI Official Symbol: ARL6IP1
• NCBI Official Synonym Symbols: AIP1; ARMER; SPG61; ARL6IP
• NCBI Protein Information: ADP-ribosylation factor-like protein 6-interacting protein 1
• UniProt Protein Name: ADP-ribosylation factor-like protein 6-interacting protein 1
• Protein Family: ADP-ribosylation factor-like protein 6-interacting protein
• UniProt Gene Name: ARL6IP1
• UniProt Synonym Gene Names: ARL-6-interacting protein 1; Aip-1
• UniProt Entry Name: AR6P1_HUMAN

NCBI Description

This gene belongs to the ARL6ip family and encodes a transmembrane protein that is predominantly localized to intracytoplasmic membranes. It is highly expressed in early myeloid progenitor cells and thought to be involved in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation. Mutations in this gene are associated with spastic paraplegia 61 (SPG61). Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2015]

Uniprot Description

ARL6IP: May be involved in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation. Belongs to the ARL6ip family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 16p12-p11.2

Cellular Component: cytosol; endoplasmic reticulum membrane; integral to endoplasmic reticulum membrane; integral to membrane; membrane; translocon complex

Molecular Function: protein binding

Biological Process: cotranslational protein targeting to membrane; negative regulation of apoptosis; negative regulation of caspase activity; positive regulation of L-glutamate transport

Disease: Spastic Paraplegia 61, Autosomal Recessive