ADP-ribosylation factor-like protein 2 Recombinant Protein | ARL2 recombinant protein

Recombinant Human ADP-ribosylation factor-like protein 2

Cat. Num. AAA717235

• Gene Names: ARL2; ARFL2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: ADP-ribosylation factor-like protein 2; Recombinant Human ADP-ribosylation factor-like protein 2; ARL2 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 19-184aa; Partial
• Sequence: LLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTAD
• Sequence Length: 157

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for ARL2 recombinant protein

Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). GTP-binding protein that does not act as an allosteric activator of the cholera toxin catalytic subunit. Regulates formation of new microtubules and centrosome integrity. Prevents the TBCD-induced microtubule destruction. Participates in association with TBCD, in the disassembly of the apical junction complexes. Antagonizes the effect of TBCD on epithelial cell detachment and tight and adherens junctions disassembly. Together with ARL2, plays a role in the nuclear translocation, retention and transcriptional activity of STAT3. Component of a regulated secretory pathway involved in Ca2+-dependent release of acetylcholine. Required for normal progress through the cell cycle.

Product Categories/Family for ARL2 recombinant protein

Cell Cycle

References

Selective amplification of additional members of the ADP-ribosylation factor (ARF) family cloning of additional human and Drosophila ARF-like genes.Clark J., Moore L., Krasinskas A., Way J., Battey J.F., Tamkun J.W., Kahn R.A.Proc. Natl. Acad. Sci. U.S.A. 90:8952-8956(1993) Kahn R.A. Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.Brandenberger R., Wei H., Zhang S., Lei S., Murage J., Fisk G.J., Li Y., Xu C., Fang R., Guegler K., Rao M.S., Mandalam R., Lebkowski J., Stanton L.W.Nat. Biotechnol. 22:707-716(2004) Human chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G., Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440:497-500(2006)

NCBI and Uniprot Product Information

• NCBI GI #: 315075338
• NCBI GeneID: 402
• NCBI Accession #: NP_001186674.1
• NCBI GenBank Nucleotide #: NM_001199745.1
• UniProt Accession #: P36404; Q9BUK8; G3V184
• Molecular Weight: 45.7 kDa
• NCBI Official Full Name: ADP-ribosylation factor-like protein 2 isoform 2
• NCBI Official Synonym Full Names: ADP ribosylation factor like GTPase 2
• NCBI Official Symbol: ARL2
• NCBI Official Synonym Symbols: ARFL2
• NCBI Protein Information: ADP-ribosylation factor-like protein 2
• UniProt Protein Name: ADP-ribosylation factor-like protein 2
• Protein Family: ADP-ribosylation factor-like protein
• UniProt Gene Name: ARL2
• UniProt Entry Name: ARL2_HUMAN

NCBI Description

This gene encodes a small GTP-binding protein of the RAS superfamily which functions as an ADP-ribosylation factor (ARF). The encoded protein is one of a functionally distinct group of ARF-like genes. [provided by RefSeq, Jul 2008]

Uniprot Description

ARL2: Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). GTP-binding protein that does not act as an allosteric activator of the cholera toxin catalytic subunit. Regulates formation of new microtubules and centrosome integrity. Prevents the TBCD-induced microtubule destruction. Participates in association with TBCD, in the disassembly of the apical junction complexes. Antagonizes the effect of TBCD on epithelial cell detachment and tight and adherens junctions disassembly. Together with ARL2, plays a role in the nuclear translocation, retention and transcriptional activity of STAT3. Component of a regulated secretory pathway involved in Ca(2+)-dependent release of acetylcholine. Required for normal progress through the cell cycle. Belongs to the small GTPase superfamily. Arf family.

Protein type: G protein, monomeric, ARF; Mitochondrial; G protein, monomeric

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: centrosome; cytosol; lateral plasma membrane; mitochondrial intermembrane space; mitochondrial matrix; nucleus

Molecular Function: GDP binding; GTP binding; GTPase activity; GTPase inhibitor activity; protein binding

Biological Process: cell cycle; centrosome organization and biogenesis; energy reserve metabolic process; maintenance of protein localization in nucleus; positive regulation of microtubule polymerization; regulation of insulin secretion; regulation of microtubule polymerization; small GTPase mediated signal transduction; tubulin folding