Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rho GDP-dissociation inhibitor 2 (Arhgdib) Recombinant Protein | Arhgdib recombinant protein

Recombinant Mouse Rho GDP-dissociation inhibitor 2 (Arhgdib)

Gene Names
Arhgdib; D4; Gdid4; Ly-GDI
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Rho GDP-dissociation inhibitor 2 (Arhgdib); Recombinant Mouse Rho GDP-dissociation inhibitor 2 (Arhgdib); Arhgdib recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-200, full length protein
Sequence
TEKDAQPQLEEADDDLDSKLNYKPPPQKSLKELQEMDKDDESLTKYKKTLLGDVPVVADPTVPNVTVTRLSLVCDSAPGPITMDLTGDLEALKKDTFVLKEGIEYRVKINFKVNKDIVSGLKYVQHTYRTGMRVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLTWEWNLAIKKDWTE
Sequence Length
199
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,851 Da
NCBI Official Full Name
rho GDP-dissociation inhibitor 2 isoform 1
NCBI Official Synonym Full Names
Rho, GDP dissociation inhibitor (GDI) beta
NCBI Official Symbol
Arhgdib
NCBI Official Synonym Symbols
D4; Gdid4; Ly-GDI
NCBI Protein Information
rho GDP-dissociation inhibitor 2
UniProt Protein Name
Rho GDP-dissociation inhibitor 2
UniProt Gene Name
Arhgdib
UniProt Synonym Gene Names
Gdid4; Rho GDI 2

NCBI Description

The protein encoded by this gene is a member of the Rho guanine nucleotide dissociation inhibitor (GDI) family. This gene is expressed at high levels in hematopoietic cells. This protein is cytosolic, and dissociation of Rho from this protein is required for membrane association and activation of Rho by Guanine Nucleotide Exchange Factors (GEFs). C-terminal truncations of this gene product have been reported to promote metastasis. Multiple transcript variants and protein isoforms exist. [provided by RefSeq, Aug 2014]

Uniprot Description

Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them. Regulates reorganization of the actin cytoskeleton mediated by Rho family members.

Research Articles on Arhgdib

Similar Products

Product Notes

The Arhgdib arhgdib (Catalog #AAA1349677) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-200, full length protein. The amino acid sequence is listed below: TEKDAQPQLE EADDDLDSKL NYKPPPQKSL KELQEMDKDD ESLTKYKKTL LGDVPVVADP TVPNVTVTRL SLVCDSAPGP ITMDLTGDLE ALKKDTFVLK EGIEYRVKIN FKVNKDIVSG LKYVQHTYRT GMRVDKATFM VGSYGPRPEE YEFLTPVEEA PKGMLARGTY HNKSFFTDDD KQDHLTWEWN LAIKKDWTE. It is sometimes possible for the material contained within the vial of "Rho GDP-dissociation inhibitor 2 (Arhgdib), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.