Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Apolipoprotein L3 (APOL3) Recombinant Protein | APOL3 recombinant protein

Recombinant Human Apolipoprotein L3 (APOL3)

Gene Names
APOL3; CG121; CG12_1; APOLIII; apoL-III
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Apolipoprotein L3 (APOL3); Recombinant Human Apolipoprotein L3 (APOL3); APOL3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-402, Full length protein
Sequence
MGLGQGWGWEASCFACLIRSCCQVVTFTFPFGFQGISQSLENVSGYYADARLEVGSTQLRTAGSCSHSFKRSFLEKKRFTEEATKYFRERVSPVHLQILLTNNEAWKRFVTAAELPRDEADALYEALKKLRTYAAIEDEYVQQKDEQFREWFLKEFPQVKRKIQESIEKLRALANGIEEVHRGCTISNVVSSSTGAASGIMSLAGLVLAPFTAGTSLALTAAGVGLGAASAVTGITTSIVEHSYTSSAEAEASRLTATSIDRLKVFKEVMRDITPNLLSLLNNYYEATQTIGSEIRAIRQARARARLPVTTWRISAGSGGQAERTIAGTTRAVSRGARILSATTSGIFLALDVVNLVYESKHLHEGAKSASAEELRRQAQELEENLMELTQIYQRLNPCHTH
Sequence Length
402
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for APOL3 recombinant protein
This gene is a member of the apolipoprotein L gene family, and it is present in a cluster with other family members on chromosome 6. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids, including cholesterol, and
or allow the binding of lipids to organelles. In addition, expression of this gene is up-regulated by tumor necrosis factor-alpha in endothelial cells lining the normal and atherosclerotic iliac artery and aorta. Alternative splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,597 Da
NCBI Official Full Name
apolipoprotein L3 isoform 2
NCBI Official Synonym Full Names
apolipoprotein L3
NCBI Official Symbol
APOL3
NCBI Official Synonym Symbols
CG121; CG12_1; APOLIII; apoL-III
NCBI Protein Information
apolipoprotein L3
UniProt Protein Name
Apolipoprotein L3
Protein Family
UniProt Gene Name
APOL3
UniProt Synonym Gene Names
ApoL-III; CG12_1

NCBI Description

This gene is a member of the apolipoprotein L gene family, and it is present in a cluster with other family members on chromosome 22. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids, including cholesterol, and/or allow the binding of lipids to organelles. In addition, expression of this gene is up-regulated by tumor necrosis factor-alpha in endothelial cells lining the normal and atherosclerotic iliac artery and aorta. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2015]

Uniprot Description

May affect the movement of lipids in the cytoplasm or allow the binding of lipids to organelles.

Research Articles on APOL3

Similar Products

Product Notes

The APOL3 apol3 (Catalog #AAA1018503) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-402, Full length protein. The amino acid sequence is listed below: MGLGQGWGWE ASCFACLIRS CCQVVTFTFP FGFQGISQSL ENVSGYYADA RLEVGSTQLR TAGSCSHSFK RSFLEKKRFT EEATKYFRER VSPVHLQILL TNNEAWKRFV TAAELPRDEA DALYEALKKL RTYAAIEDEY VQQKDEQFRE WFLKEFPQVK RKIQESIEKL RALANGIEEV HRGCTISNVV SSSTGAASGI MSLAGLVLAP FTAGTSLALT AAGVGLGAAS AVTGITTSIV EHSYTSSAEA EASRLTATSI DRLKVFKEVM RDITPNLLSL LNNYYEATQT IGSEIRAIRQ ARARARLPVT TWRISAGSGG QAERTIAGTT RAVSRGARIL SATTSGIFLA LDVVNLVYES KHLHEGAKSA SAEELRRQAQ ELEENLMELT QIYQRLNPCH TH. It is sometimes possible for the material contained within the vial of "Apolipoprotein L3 (APOL3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.