Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human ApoH Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 45-70 kDa.)

APOH recombinant protein

Recombinant Human ApoH Protein

Gene Names
APOH; BG; B2G1; B2GP1
Purity
>95% by SDS-PAGE.
Synonyms
ApoH; Recombinant Human ApoH Protein; Beta-2-Glycoprotein 1; APC inhibitor; Activated Protein C-Binding Protein; Anticardiolipin; APOH recombinant protein
Ordering
For Research Use Only!
Host
Mammalian
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Sequence
GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC
Sequence Length
345
Species
Human
Endotoxin
< 1.0 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human ApoH Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 45-70 kDa.)

SDS-Page (Recombinant Human ApoH Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 45-70 kDa.)
Related Product Information for APOH recombinant protein
Description: Recombinant Human ApoH Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Gly20-Cys345) of human ApoH (Accession #P02749) fused with a 6xHis tag at the C-terminus.

Background: Apolipoprotein H has been implicated in a variety of physiologic pathways including lipoprotein metabolism, coagulation, and the production of antiphospholipid autoantibodies. APOH may be a required cofactor for anionic phospholipid binding by the antiphospholipid autoantibodies found in sera of many patients with lupus and primary antiphospholipid syndrome, but it does not seem to be required for the reactivity of antiphospholipid autoantibodies associated with infections.
Product Categories/Family for APOH recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
350
UniProt Accession #
NCBI Official Full Name
Beta-2-glycoprotein 1
NCBI Official Synonym Full Names
apolipoprotein H
NCBI Official Symbol
APOH
NCBI Official Synonym Symbols
BG; B2G1; B2GP1
NCBI Protein Information
beta-2-glycoprotein 1
UniProt Protein Name
Beta-2-glycoprotein 1
Protein Family
UniProt Gene Name
APOH
UniProt Synonym Gene Names
B2G1; Apo-H; B2GPI; Beta(2)GPI
UniProt Entry Name
APOH_HUMAN

NCBI Description

Apolipoprotein H, also known as beta-2-glycoprotein I, is a component of circulating plasma lipoproteins. It has been implicated in a variety of physiologic pathways including lipoprotein metabolism, coagulation, hemostasis, and the production of antiphospholipid autoantibodies. APOH may be a required cofactor for anionic phospholipid binding by the antiphospholipid autoantibodies found in sera of many patients with lupus and primary antiphospholipid syndrome (APS). The anti-beta (2) glycoprotein I antibodies from APS patients, mediate inhibition of activated protein C which has anticoagulant properties. Because beta-2-GPI is the main autoantigen in patients with APS, the disruption of this pathway by autoantibodies may be an important mechanism for thrombosis in patients with APS.[provided by RefSeq, Dec 2019]

Uniprot Description

APOH: Binds to various kinds of negatively charged substances such as heparin, phospholipids, and dextran sulfate. May prevent activation of the intrinsic blood coagulation cascade by binding to phospholipids on the surface of damaged cells.

Protein type: Secreted; Lipid-binding; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 17q24.2

Cellular Component: extracellular matrix; extracellular space; chylomicron; cell surface

Molecular Function: heparin binding; identical protein binding; protein binding; phospholipid binding; glycoprotein binding; lipid binding

Biological Process: negative regulation of angiogenesis; negative regulation of myeloid cell apoptosis; triacylglycerol metabolic process; positive regulation of blood coagulation; negative regulation of fibrinolysis; negative regulation of endothelial cell proliferation; positive regulation of lipoprotein lipase activity; negative regulation of blood coagulation; triacylglycerol transport; blood coagulation, intrinsic pathway; plasminogen activation; regulation of fibrinolysis

Research Articles on APOH

Similar Products

Product Notes

The APOH apoh (Catalog #AAA9141904) is a Recombinant Protein produced from Mammalian and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: GRTCPKPDDL PFSTVVPLKT FYEPGEEITY SCKPGYVSRG GMRKFICPLT GLWPINTLKC TPRVCPFAGI LENGAVRYTT FEYPNTISFS CNTGFYLNGA DSAKCTEEGK WSPELPVCAP IICPPPSIPT FATLRVYKPS AGNNSLYRDT AVFECLPQHA MFGNDTITCT THGNWTKLPE CREVKCPFPS RPDNGFVNYP AKPTLYYKDK ATFGCHDGYS LDGPEEIECT KLGNWSAMPS CKASCKVPVK KATVVYQGER VKIQEKFKNG MLHGDKVSFF CKNKEKKCSY TEDAQCIDGT IEVPKCFKEH SSLAFWKTDA SDVKPC. It is sometimes possible for the material contained within the vial of "ApoH, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.