Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

Apolipoprotein E (Apoe) Recombinant Protein | Apoe recombinant protein

Recombinant Mouse Apolipoprotein E (Apoe)

Gene Names
Apoe; Apo-E; AI255918
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Apolipoprotein E (Apoe); Recombinant Mouse Apolipoprotein E (Apoe); Apoe recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
19-311aa; Full Length of Mature Protein
Sequence
EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

SDS-Page
Related Product Information for Apoe recombinant protein
Mediates the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron remnant) of hepatic tissues.
References
Structure and expression of mouse apolipoprotein E gene.Horiuchi K., Tajima S., Menju M., Yamamoto A.J. Biochem. 106:98-103(1989) Evolution of apolipoprotein E mouse sequence and evidence for an 11-nucleotide ancestral unit.Rajavashisth T.B., Kaptein J.S., Reue K.L., Lusis A.J.Proc. Natl. Acad. Sci. U.S.A. 82:8085-8089(1985) Neuropathological changes in scrapie and Alzheimer's disease are associated with increased expression of apolipoprotein E and cathepsin D in astrocytes.Diedrich J.F., Minnigan M., Carp R.I., Whitaker J.N., Race R., Frey W. II, Haase A.T.J. Virol. 65:4759-4768(1991) Mass spectral analysis of the apolipoproteins on mouse high density lipoproteins. Detection of post-translational modifications.Puppione D.L., Yam L.M., Bassilian S., Souda P., Castellani L.W., Schumaker V.N., Whitelegge J.P.Biochim. Biophys. Acta 1764:1363-1371(2006) Lubec G., Kang S.U.Submitted (APR-2007) to UniProtKB CD36 ligands promote sterile inflammation through assembly of a Toll-like receptor 4 and 6 heterodimer.Stewart C.R., Stuart L.M., Wilkinson K., van Gils J.M., Deng J., Halle A., Rayner K.J., Boyer L., Zhong R., Frazier W.A., Lacy-Hulbert A., El Khoury J., Golenbock D.T., Moore K.J.Nat. Immunol. 11:155-161(2010)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37.9
NCBI Official Full Name
apolipoprotein E
NCBI Official Synonym Full Names
apolipoprotein E
NCBI Official Symbol
Apoe
NCBI Official Synonym Symbols
Apo-E; AI255918
NCBI Protein Information
apolipoprotein E
UniProt Protein Name
Apolipoprotein E
Protein Family
UniProt Gene Name
Apoe
UniProt Synonym Gene Names
Apo-E
UniProt Entry Name
APOE_MOUSE

NCBI Description

This gene encodes a member of the apolipoprotein A1/A4/E family of proteins. This protein is involved in the transport of lipoproteins in the blood. It binds to a specific liver and peripheral cell receptor, and is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. Homozygous knockout mice for this gene accumulate high levels of cholesterol in the blood and develop atherosclerosis. Different alleles of this gene have been associated with either increased risk or a protective effect for Alzheimer's disease in human patients. This gene maps to chromosome 7 in a cluster with the related apolipoprotein C1, C2 and C4 genes. [provided by RefSeq, Apr 2015]

Uniprot Description

APOE: Mediates the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron remnant) of hepatic tissues. Defects in APOE are a cause of hyperlipoproteinemia type 3 (HLPP3); also known as familial dysbetalipoproteinemia. Individuals with HLPP3 are clinically characterized by xanthomas, yellowish lipid deposits in the palmar crease, or less specific on tendons and on elbows. The disorder rarely manifests before the third decade in men. In women, it is usually expressed only after the menopause. The vast majority of the patients are homozygous for APOE*2 alleles. More severe cases of HLPP3 have also been observed in individuals heterozygous for rare APOE variants. The influence of APOE on lipid levels is often suggested to have major implications for the risk of coronary artery disease (CAD). Individuals carrying the common APOE*4 variant are at higher risk of CAD. Genetic variations in APOE are associated with Alzheimer disease type 2 (AD2). It is a late-onset neurodegenerative disorder characterized by progressive dementia, loss of cognitive abilities, and deposition of fibrillar amyloid proteins as intraneuronal neurofibrillary tangles, extracellular amyloid plaques and vascular amyloid deposits. The major constituent of these plaques is the neurotoxic amyloid-beta-APP 40-42 peptide (s), derived proteolytically from the transmembrane precursor protein APP by sequential secretase processing. The cytotoxic C-terminal fragments (CTFs) and the caspase-cleaved products such as C31 derived from APP, are also implicated in neuronal death. The APOE*4 allele is genetically associated with the common late onset familial and sporadic forms of Alzheimer disease. Risk for AD increased from 20% to 90% and mean age at onset decreased from 84 to 68 years with increasing number of APOE*4 alleles in 42 families with late onset AD. Thus APOE*4 gene dose is a major risk factor for late onset AD and, in these families, homozygosity for APOE*4 was virtually sufficient to cause AD by age 80. The mechanism by which APOE*4 participates in pathogenesis is not known. Defects in APOE are a cause of sea-blue histiocyte disease (SBHD); also known as sea-blue histiocytosis. This disorder is characterized by splenomegaly, mild thrombocytopenia and, in the bone marrow, numerous histiocytes containing cytoplasmic granules which stain bright blue with the usual hematologic stains. The syndrome is the consequence of an inherited metabolic defect analogous to Gaucher disease and other sphingolipidoses. Defects in APOE are a cause of lipoprotein glomerulopathy (LPG). LPG is an uncommon kidney disease characterized by proteinuria, progressive kidney failure, and distinctive lipoprotein thrombi in glomerular capillaries. It mainly affects people of Japanese and Chinese origin. The disorder has rarely been described in Caucasians. Belongs to the apolipoprotein A1/A4/E family.

Protein type: Lipid-binding; Secreted, signal peptide; Secreted

Cellular Component: cell soma; cell surface; chylomicron; cytoplasm; dendrite; early endosome; endoplasmic reticulum; endosome; extracellular matrix; extracellular region; extracellular space; extrinsic to external side of plasma membrane; Golgi apparatus; late endosome; lysosome; membrane; microtubule; nuclear envelope; nucleus; plasma membrane

Molecular Function: antioxidant activity; beta-amyloid binding; cholesterol binding; cholesterol transporter activity; heparin binding; hydroxyapatite binding; identical protein binding; lipid binding; lipid transporter activity; low-density lipoprotein receptor binding; metal chelating activity; phospholipid binding; protein binding; protein homodimerization activity; receptor binding; tau protein binding

Biological Process: aging; artery morphogenesis; axon regeneration; cellular calcium ion homeostasis; cGMP-mediated signaling; cholesterol biosynthetic process; cholesterol catabolic process; cholesterol efflux; cholesterol homeostasis; cholesterol metabolic process; fatty acid homeostasis; G-protein coupled receptor protein signaling pathway; lipid homeostasis; lipid metabolic process; lipid transport; lipoprotein biosynthetic process; lipoprotein catabolic process; lipoprotein metabolic process; long-chain fatty acid transport; maintenance of cellular localization; negative regulation of blood coagulation; negative regulation of blood vessel endothelial cell migration; negative regulation of cholesterol biosynthetic process; negative regulation of endothelial cell proliferation; negative regulation of inflammatory response; negative regulation of lipid biosynthetic process; negative regulation of MAP kinase activity; negative regulation of neuron apoptosis; nitric oxide mediated signal transduction; phospholipid efflux; positive regulation of axon extension; positive regulation of cGMP biosynthetic process; positive regulation of lipid biosynthetic process; positive regulation of low-density lipoprotein receptor catabolic process; positive regulation of membrane protein ectodomain proteolysis; positive regulation of nitric-oxide synthase activity; protein import; protein localization; receptor-mediated endocytosis; regulation of axon extension; regulation of Cdc42 protein signal transduction; regulation of cholesterol transport; regulation of gene expression; response to dietary excess; response to oxidative stress; reverse cholesterol transport; transport; triacylglycerol catabolic process; triacylglycerol metabolic process; vasodilation; virus assembly

Research Articles on Apoe

Similar Products

Product Notes

The Apoe apoe (Catalog #AAA955382) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-311aa; Full Length of Mature Protein. The amino acid sequence is listed below: EGEPEVTDQL EWQSNQPWEQ ALNRFWDYLR WVQTLSDQVQ EELQSSQVTQ ELTALMEDTM TEVKAYKKEL EEQLGPVAEE TRARLGKEVQ AAQARLGADM EDLRNRLGQY RNEVHTMLGQ STEEIRARLS THLRKMRKRL MRDAEDLQKR LAVYKAGARE GAERGVSAIR ERLGPLVEQG RQRTANLGAG AAQPLRDRAQ AFGDRIRGRL EEVGNQARDR LEEVREHMEE VRSKMEEQTQ QIRLQAEIFQ ARLKGWFEPI VEDMHRQWAN LMEKIQASVA TNPIITPVAQ ENQ. It is sometimes possible for the material contained within the vial of "Apolipoprotein E (Apoe), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.