Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Apolipoprotein C-I (APOC1) Recombinant Protein | APOC1 recombinant protein

Recombinant Human Apolipoprotein C-I (APOC1)

Gene Names
APOC1; Apo-CI; ApoC-I; apo-CIB; apoC-IB
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Apolipoprotein C-I (APOC1); Recombinant Human Apolipoprotein C-I (APOC1); Apolipoprotein C1; Apo-CI; ApoC-I; APOC1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
27-83aa; Full Length of Mature Protein
Sequence
TPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS
Sequence Length
83
Species
Human
Tag
Tag-Free
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for APOC1 recombinant protein
Inhibitor of lipoprotein binding to the low density lipoprotein receptor, LDL receptor-related protein, and very low density lipoprotein receptor. Associates with high density lipoproteins and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein. Binds free fatty acids and reduces their intracellular esterification. Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein.
Product Categories/Family for APOC1 recombinant protein
References
"Sequencing of 42kb of the APO E-C2 gene cluster reveals a new gene: PEREC1." Freitas E.M., Zhang W.J., Lalonde J.P., Tay G.K., Gaudieri S., Ashworth L.K., Van Bockxmeer F.M., Dawkins R.L. DNA Seq. 9:89-100(1998).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
341
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
6.6 kDa
NCBI Official Full Name
apolipoprotein C-I
NCBI Official Synonym Full Names
apolipoprotein C1
NCBI Official Symbol
APOC1
NCBI Official Synonym Symbols
Apo-CI; ApoC-I; apo-CIB; apoC-IB
NCBI Protein Information
apolipoprotein C-I
UniProt Protein Name
Apolipoprotein C-I
Protein Family
UniProt Gene Name
APOC1
UniProt Synonym Gene Names
APOC1B; Apo-CIB; ApoC-IB; Apo-CIB'; ApoC-IB'
UniProt Entry Name
APOC1_HUMAN

NCBI Description

This gene encodes a member of the apolipoprotein C1 family. This gene is expressed primarily in the liver, and it is activated when monocytes differentiate into macrophages. The encoded protein plays a central role in high density lipoprotein (HDL) and very low density lipoprotein (VLDL) metabolism. This protein has also been shown to inhibit cholesteryl ester transfer protein in plasma. A pseudogene of this gene is located 4 kb downstream in the same orientation, on the same chromosome. This gene is mapped to chromosome 19, where it resides within a apolipoprotein gene cluster. Alternative splicing and the use of alternative promoters results in multiple transcript variants. [provided by RefSeq, Sep 2016]

Uniprot Description

APOC1: Appears to modulate the interaction of APOE with beta- migrating VLDL and inhibit binding of beta-VLDL to the LDL receptor-related protein. Binds free fatty acids and reduces their intracellular esterification. Belongs to the apolipoprotein C1 family.

Protein type: Lipid-binding; Inhibitor; Secreted, signal peptide; Secreted; Endoplasmic reticulum

Chromosomal Location of Human Ortholog: 19q13.2

Cellular Component: chylomicron; endoplasmic reticulum

Molecular Function: phospholipase inhibitor activity; lipase inhibitor activity; phosphatidylcholine binding; fatty acid binding

Biological Process: positive regulation of catalytic activity; cholesterol metabolic process; negative regulation of cholesterol transport; cholesterol efflux; lipoprotein metabolic process; triacylglycerol metabolic process; phospholipid efflux; negative regulation of lipid catabolic process; negative regulation of receptor-mediated endocytosis; negative regulation of lipoprotein lipase activity; lipid metabolic process; regulation of cholesterol transport; negative regulation of lipid metabolic process; negative regulation of fatty acid biosynthetic process

Research Articles on APOC1

Similar Products

Product Notes

The APOC1 apoc1 (Catalog #AAA7115185) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 27-83aa; Full Length of Mature Protein. The amino acid sequence is listed below: TPDVSSALDK LKEFGNTLED KARELISRIK QSELSAKMRE WFSETFQKVK EKLKIDS. It is sometimes possible for the material contained within the vial of "Apolipoprotein C-I (APOC1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.