apolipoprotein B48 (APOB) Recombinant Protein | APOB recombinant protein

Recombinant Human apolipoprotein B48 (APOB) Protein

Cat. Num. AAA286102

• Gene Names: APOBR; APOB48R; APOB100R
• Purity: > 90% as determined by SDS-PAGE
• Synonyms: apolipoprotein B48 (APOB); Recombinant Human apolipoprotein B48 (APOB) Protein; Apo-B; FLDB; Apo B-100; Apo B-48.; APOB recombinant protein

• Host: E. coli AA 28-127 (P04114).
• Purity/Purification: > 90% as determined by SDS-PAGE
• Form/Format: 10 mM Tris-HCl, 1 mM EDTA, pH 8.0, 50% glycerol.
• Concentration: 0.75 mg/mL (varies by lot)
• Sequence: EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS

• Species: Human
• Source: Human
• Protein Residues: with N-terminal 10×His-tagged.
• Endotoxin Level: Please contact us for more information.
• Usage: APOB Protein - Centrifuge the standard vial at 6000-10000rpm for 30s.
• Preparation and Storage: Store it under sterile conditions at -20°C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage. The recombinant protein is stable for up to 6-12 months from date of receipt at -20°C to -80°C. **Avoid repeated freeze-thaw cycles.**

SDS-PAGE

Related Product Information for APOB recombinant protein

Apolipoprotein B (APOB) is the primary apolipoprotein of low-density lipoproteins (LDL or "bad cholesterol"), which is responsible for carrying cholesterol to tissues. While it is unclear exactly what functional role APOB plays in LDL, it is the primary apolipoprotein component and is absolutely required for its formation. What is clear is that the APOB on the LDL particle acts as a ligand for LDL receptors in various cells throughout the body. Through a mechanism that is not fully understood, high levels of APOB can lead to plaques that cause vascular disease (atherosclerosis), leading to heart disease. There is considerable evidence that levels of APOB are a better indicator of heart disease risk than total cholesterol or LDL.

NCBI and Uniprot Product Information

• NCBI GI #: 340138932
• NCBI GeneID: 55911
• NCBI Accession #: NP_061160.3
• NCBI GenBank Nucleotide #: NM_018690.3
• UniProt Accession #: Q0VD83; Q0VD81; Q8NC15; Q9NPJ9; H3BU97
• Molecular Weight: Predicted MW: 14.7 kDa; Observed MW: 17 kDa; (The reducing (R) protein migrates as xx kDa in SDS-PAGE may be due to relative charge.)
• NCBI Official Full Name: apolipoprotein B receptor
• NCBI Official Synonym Full Names: apolipoprotein B receptor
• NCBI Official Symbol: APOBR
• NCBI Official Synonym Symbols: APOB48R; APOB100R
• NCBI Protein Information: apolipoprotein B receptor
• UniProt Protein Name: Apolipoprotein B receptor
• Protein Family: Apolipoprotein
• UniProt Gene Name: APOBR
• UniProt Synonym Gene Names: APOB48R; Apolipoprotein B48 receptor; apoB-48R
• UniProt Entry Name: APOBR_HUMAN

NCBI Description

Apolipoprotein B48 receptor is a macrophage receptor that binds to the apolipoprotein B48 of dietary triglyceride (TG)-rich lipoproteins. This receptor may provide essential lipids, lipid-soluble vitamins and other nutrients to reticuloendothelial cells. If overwhelmed with elevated plasma triglyceride, the apolipoprotein B48 receptor may contribute to foam cell formation, endothelial dysfunction, and atherothrombogenesis. [provided by RefSeq, Jul 2008]

Uniprot Description

Macrophage receptor that binds to the apolipoprotein B48 (APOB) of dietary triglyceride (TG)-rich lipoproteins (TRL) or to a like domain of APOB in hypertriglyceridemic very low density lipoprotein (HTG-VLDL). Binds and internalizes TRL when out of the context of the macrophage. May provide essential lipids to reticuloendothelial cells. Could also be involved in foam cell formation with elevated TRL and remnant lipoprotein (RLP). Mediates the rapid high-affinity uptake of chylomicrons (CM), HTG-VLDL, and trypsinized (tryp) VLDL devoid of APOE in vitro in macrophages.