AP-3 complex subunit mu-2 (Ap3m2) Recombinant Protein | Ap3m2 recombinant protein
Recombinant Mouse AP-3 complex subunit mu-2 (Ap3m2)
Gene Names
Ap3m2; AP-3B; 5830445E16Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
AP-3 complex subunit mu-2 (Ap3m2); Recombinant Mouse AP-3 complex subunit mu-2 (Ap3m2); Ap3m2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-418, full length protein
Sequence
MIHSLFLINSSGDIFLEKHWKSVVSRSVCDYFFEAQERATEAENVPPVIPTPHHYLLSVYRHKIFFVAVIQTEVPPLFVIEFLHRVVDTFQDYFGVCSEPVIKDNVVVVYEVLEEMLDNGFPLATESNILKELIKPPTILRTVVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVVEEIDAIIDKSGSTVTAEIQGVIDACVKLTGMPDLTLSFMNPRLLDDVSFHPCVRFKRWESERILSFIPPDGNFRLLAYHVSAQNLVAIPVYVKHSISFRDSSSLGRFEITVGPKQTMGKTIEGVIVTSQMPKGVLNMSLTPSQGTHTFDPVTKMLSWDVGKINPQKLPSLKGTMGLQVGASKPDENPTINLQFKIQQLAISGLKVNRLDMYGEKYKPFKGIKYMTKAGKFQVRT
Sequence Length
418
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Ap3m2 recombinant protein
This gene encodes a subunit of the heterotetrameric adaptor-related protein comlex 3 (AP-3), which belongs to the adaptor complexes medium subunits family. The AP-3 complex plays a role in protein trafficking to lysosomes and specialized organelles. Multiple alternatively spliced variants, encoding the same protein, have been identified.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
46,916 Da
NCBI Official Full Name
AP-3 complex subunit mu-2
NCBI Official Synonym Full Names
adaptor-related protein complex 3, mu 2 subunit
NCBI Official Symbol
Ap3m2
NCBI Official Synonym Symbols
AP-3B; 5830445E16Rik
NCBI Protein Information
AP-3 complex subunit mu-2
UniProt Protein Name
AP-3 complex subunit mu-2
Protein Family
UniProt Gene Name
Ap3m2
UniProt Synonym Gene Names
m3B
Uniprot Description
Component of the adaptor complexes which link clathrin to receptors in coated vesicles. Clathrin-associated protein complexes are believed to interact with the cytoplasmic tails of membrane proteins, leading to their selection and concentration. Ap47 is a subunit of the plasma membrane adaptor (). In concert with the BLOC-1 complex, AP-3 is required to target cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals.
Research Articles on Ap3m2
Similar Products
Product Notes
The Ap3m2 ap3m2 (Catalog #AAA1467642) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-418, full length protein. The amino acid sequence is listed below: MIHSLFLINS SGDIFLEKHW KSVVSRSVCD YFFEAQERAT EAENVPPVIP TPHHYLLSVY RHKIFFVAVI QTEVPPLFVI EFLHRVVDTF QDYFGVCSEP VIKDNVVVVY EVLEEMLDNG FPLATESNIL KELIKPPTIL RTVVNTITGS TNVGDQLPTG QLSVVPWRRT GVKYTNNEAY FDVVEEIDAI IDKSGSTVTA EIQGVIDACV KLTGMPDLTL SFMNPRLLDD VSFHPCVRFK RWESERILSF IPPDGNFRLL AYHVSAQNLV AIPVYVKHSI SFRDSSSLGR FEITVGPKQT MGKTIEGVIV TSQMPKGVLN MSLTPSQGTH TFDPVTKMLS WDVGKINPQK LPSLKGTMGL QVGASKPDEN PTINLQFKIQ QLAISGLKVN RLDMYGEKYK PFKGIKYMTK AGKFQVRT. It is sometimes possible for the material contained within the vial of "AP-3 complex subunit mu-2 (Ap3m2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
