AP-2 complex subunit sigma (AP2S1) Recombinant Protein | AP2S1 recombinant protein

Recombinant Human AP-2 complex subunit sigma (AP2S1)

Cat. Num. AAA954417

• Gene Names: AP2S1; AP17; FBH3; HHC3; FBHOk; CLAPS2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: AP-2 complex subunit sigma (AP2S1); Recombinant Human AP-2 complex subunit sigma (AP2S1); AP2S1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-142, Full length protein
• Sequence: MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
• Sequence Length: 142

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for AP2S1 recombinant protein

One of two major clathrin-associated adaptor complexes, AP-2, is a heterotetramer which is associated with the plasma membrane. This complex is composed of two large chains, a medium chain, and a small chain. This gene encodes the small chain of this complex. Alternative splicing has been observed in this gene and results in two known transcripts.

NCBI and Uniprot Product Information

• NCBI GI #: 666637993
• NCBI GeneID: 1175
• NCBI Accession #: NP_001288005.1
• NCBI GenBank Nucleotide #: NM_001301076.1
• UniProt Accession #: P53680; O75977; Q6PK67; B2R4Z4
• Molecular Weight: 12,417 Da
• NCBI Official Full Name: AP-2 complex subunit sigma isoform 3
• NCBI Official Synonym Full Names: adaptor related protein complex 2 sigma 1 subunit
• NCBI Official Symbol: AP2S1
• NCBI Official Synonym Symbols: AP17; FBH3; HHC3; FBHOk; CLAPS2
• NCBI Protein Information: AP-2 complex subunit sigma
• UniProt Protein Name: AP-2 complex subunit sigma
• Protein Family: AP-2 complex
• UniProt Gene Name: AP2S1
• UniProt Synonym Gene Names: AP17; CLAPS2

NCBI Description

One of two major clathrin-associated adaptor complexes, AP-2, is a heterotetramer which is associated with the plasma membrane. This complex is composed of two large chains, a medium chain, and a small chain. This gene encodes the small chain of this complex. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]

Uniprot Description

Component of the adaptor protein complex 2 (AP-2). Adaptor protein complexes function in protein Transport via Transport vesicles in different membrane traffic pathways. Adaptor protein complexes are vesicle coat components and appear to be involved in cargo selection and vesicle formation. AP-2 is involved in clathrin-dependent endocytosis in which cargo proteins are incorporated into vesicles surrounded by clathrin (clathrin-coated vesicles, CCVs) which are destined for fusion with the early endosome. The clathrin lattice serves as a mechanical scaffold but is itself unable to bind directly to membrane components. Clathrin-associated adaptor protein (AP) complexes which can bind directly to both the clathrin lattice and to the lipid and protein components of membranes are considered to be the major clathrin adaptors contributing the CCV formation. AP-2 also serves as a cargo receptor to selectively sort the membrane proteins involved in receptor-mediated endocytosis. AP-2 seems to play a role in the recycling of synaptic vesicle membranes from the presynaptic surface. AP-2 recognizes Y-X-X-[FILMV] (Y-X-X-Phi) and [ED]-X-X-X-L-[LI] endocytosis signal motifs within the cytosolic tails of transmembrane cargo molecules. AP-2 may also play a role in maintaining normal post-endocytic trafficking through the ARF6-regulated, non-clathrin pathway. The AP-2 alpha and AP-2 sigma subunits are thought to contribute to the recognition of the [ED]-X-X-X-L-[LI] motif (). May also play a role in extracellular calcium homeostasis.