Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Angiopoietin-2 Recombinant Protein | Angpt2 recombinant protein

Recombinant Mouse Angiopoietin-2

Gene Names
Angpt2; Ang2; Agpt2; Ang-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Angiopoietin-2; Recombinant Mouse Angiopoietin-2; Angpt2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
19-483aa; Partial
Sequence
YSNFRKSVDSTGRRQYQVQNGPCSYTFLLPETDSCRSSSSPYMSNAVQRDAPLDYDDSVQRLQVLENILENNTQWLMKLENYIQDNMKKEMVEIQQNVVQNQTAVMIEIGTSLLNQTAAQTRKLTDVEAQVLNQTTRLELQLLQHSISTNKLEKQILDQTSEINKLQNKNSFLEQKVLDMEGKHSEQLQSMKEQKDELQVLVSKQSSVIDELEKKLVTATVNNSLLQKQQHDLMETVNSLLTMMSSPNSKSSVAIRKEEQTTFRDCAEIFKSGLTTSGIYTLTFPNSTEEIKAYCDMDVGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEESNYRIHLTGLTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLSGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYS
Sequence Length
496
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for Angpt2 recombinant protein
Binds to TEK/TIE2, competing for the ANGPT1 binding site, and modulating ANGPT1 signaling. Can induce tyrosine phosphorylation of TEK/TIE2 in the absence of ANGPT1. In the absence of angiogenic inducers, such as VEGF, ANGPT2-mediated loosening of cell-matrix contacts may induce endothelial cell apoptosis with consequent vascular regression. In concert with VEGF, it may facilitate endothelial cell migration and proliferation, thus serving as a permissive angiogenic signal.
References
Angiopoietin-2, a natural antagonist for Tie2 that disrupts in vivo angiogenesis.Maisonpierre P.C., Suri C., Jones P.F., Bartunkova S., Wiegand S.J., Radziejewski C., Compton D.L., McClain J., Aldrich T.H., Papadopoulos N., Daly T.J., Davis S., Sato T.N., Yancopoulos G.D.Science 277:55-60(1997)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57 kDa
NCBI Official Full Name
angiopoietin-2
NCBI Official Synonym Full Names
angiopoietin 2
NCBI Official Symbol
Angpt2
NCBI Official Synonym Symbols
Ang2; Agpt2; Ang-2
NCBI Protein Information
angiopoietin-2
UniProt Protein Name
Angiopoietin-2
Protein Family
UniProt Gene Name
Angpt2
UniProt Synonym Gene Names
Agpt2; ANG-2
UniProt Entry Name
ANGP2_MOUSE

NCBI Description

This gene encodes an endothelial cell (EC)-derived regulator of angiogenesis and ligand for endothelial-specific receptor tyrosine kinase. The encoded protein acts as an anti-apoptotic factor for stressed ECs and a proapoptotic factor for resting ECs. [provided by RefSeq, Jan 2013]

Uniprot Description

ANGPT2: Binds to TEK/TIE2, competing for the ANGPT1 binding site, and modulating ANGPT1 signaling. Can induce tyrosine phosphorylation of TEK/TIE2 in the absence of ANGPT1. In the absence of angiogenic inducers, such as VEGF, ANGPT2-mediated loosening of cell-matrix contacts may induce endothelial cell apoptosis with consequent vascular regression. In concert with VEGF, it may facilitate endothelial cell migration and proliferation, thus serving as a permissive angiogenic signal. Interacts with TEK/TIE2, competing for the same binding site as ANGPT1. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted

Cellular Component: cell projection; extracellular region; extracellular space; nucleus; plasma membrane

Molecular Function: metal ion binding; protein binding; receptor tyrosine kinase binding; vascular endothelial growth factor receptor binding

Biological Process: angiogenesis; blood vessel morphogenesis; blood vessel remodeling; cell differentiation; endoderm development; hemopoiesis; multicellular organismal development; negative regulation of angiogenesis; negative regulation of blood vessel endothelial cell migration; negative regulation of positive chemotaxis; positive regulation of angiogenesis; regulation of angiogenesis; Tie receptor signaling pathway; transmembrane receptor protein tyrosine kinase signaling pathway

Research Articles on Angpt2

Similar Products

Product Notes

The Angpt2 angpt2 (Catalog #AAA1265575) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-483aa; Partial. The amino acid sequence is listed below: YSNFRKSVDS TGRRQYQVQN GPCSYTFLLP ETDSCRSSSS PYMSNAVQRD APLDYDDSVQ RLQVLENILE NNTQWLMKLE NYIQDNMKKE MVEIQQNVVQ NQTAVMIEIG TSLLNQTAAQ TRKLTDVEAQ VLNQTTRLEL QLLQHSISTN KLEKQILDQT SEINKLQNKN SFLEQKVLDM EGKHSEQLQS MKEQKDELQV LVSKQSSVID ELEKKLVTAT VNNSLLQKQQ HDLMETVNSL LTMMSSPNSK SSVAIRKEEQ TTFRDCAEIF KSGLTTSGIY TLTFPNSTEE IKAYCDMDVG GGGWTVIQHR EDGSVDFQRT WKEYKEGFGS PLGEYWLGNE FVSQLTGQHR YVLKIQLKDW EGNEAHSLYD HFYLAGEESN YRIHLTGLTG TAGKISSISQ PGSDFSTKDS DNDKCICKCS QMLSGGWWFD ACGPSNLNGQ YYPQKQNTNK FNGIKWYYWK GSGYS. It is sometimes possible for the material contained within the vial of "Angiopoietin-2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.