Pancreatic alpha-amylase (AMY2) Recombinant Protein | AMY2 recombinant protein
Recombinant Pig Pancreatic alpha-amylase (AMY2)
Gene Names
AMY2; AMY2B
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Pancreatic alpha-amylase (AMY2); Recombinant Pig Pancreatic alpha-amylase (AMY2); AMY2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
16-511, Full length protein
Sequence
QYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENIVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGNREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIQSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKVAVGFMLAHPYGFTRVMSSYRWARNFVNGQDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWRQIRNMVWFRNVVDGQPFANWWANGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL
Sequence Length
496
Species
Sus scrofa (Pig)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
57,086 Da
NCBI Official Full Name
pancreatic alpha-amylase
NCBI Official Symbol
AMY2
NCBI Official Synonym Symbols
AMY2B
NCBI Protein Information
pancreatic alpha-amylase
UniProt Protein Name
Pancreatic alpha-amylase
Protein Family
UniProt Gene Name
AMY2
UniProt Synonym Gene Names
PA
Uniprot Description
MiscellaneousThe two forms of this enzyme, I and II, show very similar activities, molecular masses, and compositions and differ only in their isoelectric points. As no evidence for two variants were in the cDNA library of PubMed:10082956, it is most likely that isoform I (PPAI) and isoform II (PPAII) are two forms of the same protein.
Research Articles on AMY2
Similar Products
Product Notes
The AMY2 amy2 (Catalog #AAA1026241) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 16-511, Full length protein. The amino acid sequence is listed below: QYAPQTQSGR TSIVHLFEWR WVDIALECER YLGPKGFGGV QVSPPNENIV VTNPSRPWWE RYQPVSYKLC TRSGNENEFR DMVTRCNNVG VRIYVDAVIN HMCGSGAAAG TGTTCGSYCN PGNREFPAVP YSAWDFNDGK CKTASGGIES YNDPYQVRDC QLVGLLDLAL EKDYVRSMIA DYLNKLIDIG VAGFRIDASK HMWPGDIKAV LDKLHNLNTN WFPAGSRPFI FQEVIDLGGE AIQSSEYFGN GRVTEFKYGA KLGTVVRKWS GEKMSYLKNW GEGWGFMPSD RALVFVDNHD NQRGHGAGGA SILTFWDARL YKVAVGFMLA HPYGFTRVMS SYRWARNFVN GQDVNDWIGP PNNNGVIKEV TINADTTCGN DWVCEHRWRQ IRNMVWFRNV VDGQPFANWW ANGSNQVAFG RGNRGFIVFN NDDWQLSSTL QTGLPGGTYC DVISGDKVGN SCTGIKVYVS SDGTAQFSIS NSAEDPFIAI HAESKL. It is sometimes possible for the material contained within the vial of "Pancreatic alpha-amylase (AMY2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
