Testing Data
Alpha-amylase 1 (AMY1A) Recombinant Protein | AMY1A recombinant protein
Recombinant Human Alpha-amylase 1 (AMY1A)
Gene Names
AMY1B; AMY1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Alpha-amylase 1 (AMY1A); Recombinant Human Alpha-amylase 1 (AMY1A); Alpha-amylase 1; EC=3.2.1.1; 1; 4-alpha-D-glucan glucanohydrolase 1; Salivary alpha-amylase; AMY1A recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
16-511, Full length protein
Sequence
QYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Sequence Length
496
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Testing Data
Testing Data
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
57,768 Da
NCBI Official Full Name
alpha-amylase 1
NCBI Official Synonym Full Names
amylase, alpha 1B (salivary)
NCBI Official Symbol
AMY1B
NCBI Official Synonym Symbols
AMY1
NCBI Protein Information
alpha-amylase 1; glycogenase; salivary alpha-amylase; salivary amylase alpha 1B; amylase, salivary, alpha-1B; 1,4-alpha-D-glucan glucanohydrolase 1
UniProt Protein Name
Alpha-amylase 1
UniProt Gene Name
AMY1A
UniProt Synonym Gene Names
AMY1
UniProt Entry Name
AMY1_HUMAN
NCBI Description
Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. This gene encodes an amylase isoenzyme produced by the salivary gland. [provided by RefSeq, Jul 2008]
Uniprot Description
AMY1: Monomer. Belongs to the glycosyl hydrolase 13 family.
Protein type: Secreted, signal peptide; Hydrolase; Carbohydrate Metabolism - starch and sucrose; EC 3.2.1.1; Secreted
Chromosomal Location of Human Ortholog: 1p21
Cellular Component: extracellular space
Molecular Function: alpha-amylase activity; protein binding; metal ion binding
Biological Process: digestion; carbohydrate metabolic process
Research Articles on AMY1A
Similar Products
Product Notes
The AMY1A amy1a (Catalog #AAA1190835) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 16-511, Full length protein. The amino acid sequence is listed below: QYSSNTQQGR TSIVHLFEWR WVDIALECER YLAPKGFGGV QVSPPNENVA IHNPFRPWWE RYQPVSYKLC TRSGNEDEFR NMVTRCNNVG VRIYVDAVIN HMCGNAVSAG TSSTCGSYFN PGSRDFPAVP YSGWDFNDGK CKTGSGDIEN YNDATQVRDC RLSGLLDLAL GKDYVRSKIA EYMNHLIDIG VAGFRIDASK HMWPGDIKAI LDKLHNLNSN WFPEGSKPFI YQEVIDLGGE PIKSSDYFGN GRVTEFKYGA KLGTVIRKWN GEKMSYLKNW GEGWGFMPSD RALVFVDNHD NQRGHGAGGA SILTFWDARL YKMAVGFMLA HPYGFTRVMS SYRWPRYFEN GKDVNDWVGP PNDNGVTKEV TINPDTTCGN DWVCEHRWRQ IRNMVNFRNV VDGQPFTNWY DNGSNQVAFG RGNRGFIVFN NDDWTFSLTL QTGLPAGTYC DVISGDKING NCTGIKIYVS DDGKAHFSIS NSAEDPFIAI HAESKL. It is sometimes possible for the material contained within the vial of "Alpha-amylase 1 (AMY1A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
